SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378453385|ref|YP_005240745.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378453385|ref|YP_005240745.1|
Domain Number 1 Region: 211-267
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000898
Family AraC type transcriptional activator 0.027
Further Details:      
 
Domain Number 2 Region: 9-103
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.000000000756
Family TM1287-like 0.063
Further Details:      
 
Domain Number 3 Region: 159-209
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000199
Family AraC type transcriptional activator 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378453385|ref|YP_005240745.1|
Sequence length 274
Comment putative DNA-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MAYVSQVSESNGPFVRFMHMHPQTVELILITEGDGEYFIGDRIYPVRKGDLVIYNSQVVH
DEYLESGRPIGTICCGINNISCPGLRENALIPDDIVPVIPLYHHYATVEKLMSSVFTVIN
QHAVEGPAMAQLLTQVVLKYIEGNVLLRTGNDAIQRHENLLDSIKSYIDRNFYEPIRLDT
LATKFNVSPYYVSHEFKRRYGYSPMDYLIKRRLGEAQSLLTTDEGGREKITSIAYRVGFS
NLSHFQNYFKNKVGKTPGQYRKDYRKANYLLFEY
Download sequence
Identical sequences A0A0F6BAU7 A0A0H3NW10 A0A1Z3WWT5 A0A221Z4W6 A0A249V395 A0A271D279 A0A2C6ZZ09 A0A2D1XWQ7 A0A2D1YA86 A0A2H9YK30 A0A2J0RHJ2 B5F3F1 E8XBH6 Q8ZK59 S5HPN6
380030 454166.SeAg_B4704 99287.STM4423 gi|549726932|ref|YP_008647122.1| gi|550903759|ref|YP_008672851.1| gi|526218832|ref|YP_008264093.1| gi|525839655|ref|YP_008256992.1| NP_463284.1.58477 WP_000332219.1.100007 WP_000332219.1.100010 WP_000332219.1.100031 WP_000332219.1.10013 WP_000332219.1.100165 WP_000332219.1.100234 WP_000332219.1.100258 WP_000332219.1.100266 WP_000332219.1.100288 WP_000332219.1.100376 WP_000332219.1.100413 WP_000332219.1.100424 WP_000332219.1.100432 WP_000332219.1.100436 WP_000332219.1.100438 WP_000332219.1.100484 WP_000332219.1.100488 WP_000332219.1.100597 WP_000332219.1.100650 WP_000332219.1.100707 WP_000332219.1.100714 WP_000332219.1.100721 WP_000332219.1.10076 WP_000332219.1.100773 WP_000332219.1.100781 WP_000332219.1.100790 WP_000332219.1.100793 WP_000332219.1.100865 WP_000332219.1.100869 WP_000332219.1.100871 WP_000332219.1.100882 WP_000332219.1.100932 WP_000332219.1.101007 WP_000332219.1.101020 WP_000332219.1.101042 WP_000332219.1.101074 WP_000332219.1.101078 WP_000332219.1.101126 WP_000332219.1.101180 WP_000332219.1.101185 WP_000332219.1.101199 WP_000332219.1.101259 WP_000332219.1.101284 WP_000332219.1.101320 WP_000332219.1.101353 WP_000332219.1.101386 WP_000332219.1.101404 WP_000332219.1.101420 WP_000332219.1.101425 WP_000332219.1.101454 WP_000332219.1.101589 WP_000332219.1.101609 WP_000332219.1.101612 WP_000332219.1.101636 WP_000332219.1.101707 WP_000332219.1.101724 WP_000332219.1.101734 WP_000332219.1.101741 WP_000332219.1.101759 WP_000332219.1.101776 WP_000332219.1.101815 WP_000332219.1.101841 WP_000332219.1.101878 WP_000332219.1.10191 WP_000332219.1.101953 WP_000332219.1.101975 WP_000332219.1.102009 WP_000332219.1.10220 WP_000332219.1.10266 WP_000332219.1.10276 WP_000332219.1.10293 WP_000332219.1.10310 WP_000332219.1.10394 WP_000332219.1.10429 WP_000332219.1.10439 WP_000332219.1.10463 WP_000332219.1.10507 WP_000332219.1.10521 WP_000332219.1.10562 WP_000332219.1.10568 WP_000332219.1.10678 WP_000332219.1.10711 WP_000332219.1.10720 WP_000332219.1.10753 WP_000332219.1.10797 WP_000332219.1.10992 WP_000332219.1.11000 WP_000332219.1.11024 WP_000332219.1.11031 WP_000332219.1.11098 WP_000332219.1.11168 WP_000332219.1.11190 WP_000332219.1.11254 WP_000332219.1.1135 WP_000332219.1.11369 WP_000332219.1.1137 WP_000332219.1.11405 WP_000332219.1.11455 WP_000332219.1.11458 WP_000332219.1.11479 WP_000332219.1.11518 WP_000332219.1.11532 WP_000332219.1.11543 WP_000332219.1.11544 WP_000332219.1.11565 WP_000332219.1.11603 WP_000332219.1.11621 WP_000332219.1.11763 WP_000332219.1.11875 WP_000332219.1.11897 WP_000332219.1.11936 WP_000332219.1.11964 WP_000332219.1.12007 WP_000332219.1.12025 WP_000332219.1.12047 WP_000332219.1.12059 WP_000332219.1.12063 WP_000332219.1.12114 WP_000332219.1.12160 WP_000332219.1.12280 WP_000332219.1.12282 WP_000332219.1.12351 WP_000332219.1.12370 WP_000332219.1.12397 WP_000332219.1.12456 WP_000332219.1.12484 WP_000332219.1.1250 WP_000332219.1.12546 WP_000332219.1.1264 WP_000332219.1.12650 WP_000332219.1.12701 WP_000332219.1.12718 WP_000332219.1.12728 WP_000332219.1.12864 WP_000332219.1.12879 WP_000332219.1.12936 WP_000332219.1.12995 WP_000332219.1.13027 WP_000332219.1.13106 WP_000332219.1.13130 WP_000332219.1.13334 WP_000332219.1.13414 WP_000332219.1.13446 WP_000332219.1.13488 WP_000332219.1.13509 WP_000332219.1.13528 WP_000332219.1.13543 WP_000332219.1.13669 WP_000332219.1.13677 WP_000332219.1.13741 WP_000332219.1.13750 WP_000332219.1.13799 WP_000332219.1.13819 WP_000332219.1.13829 WP_000332219.1.13848 WP_000332219.1.1387 WP_000332219.1.13908 WP_000332219.1.13932 WP_000332219.1.13968 WP_000332219.1.14001 WP_000332219.1.14050 WP_000332219.1.14056 WP_000332219.1.14151 WP_000332219.1.14212 WP_000332219.1.14320 WP_000332219.1.14379 WP_000332219.1.14406 WP_000332219.1.14410 WP_000332219.1.14446 WP_000332219.1.14466 WP_000332219.1.14524 WP_000332219.1.14528 WP_000332219.1.14554 WP_000332219.1.14688 WP_000332219.1.14706 WP_000332219.1.14725 WP_000332219.1.14789 WP_000332219.1.14808 WP_000332219.1.14852 WP_000332219.1.14876 WP_000332219.1.14884 WP_000332219.1.1489 WP_000332219.1.14917 WP_000332219.1.14932 WP_000332219.1.14936 WP_000332219.1.15055 WP_000332219.1.15059 WP_000332219.1.15079 WP_000332219.1.15100 WP_000332219.1.15102 WP_000332219.1.15124 WP_000332219.1.15223 WP_000332219.1.15226 WP_000332219.1.15316 WP_000332219.1.15369 WP_000332219.1.1540 WP_000332219.1.15479 WP_000332219.1.15508 WP_000332219.1.15586 WP_000332219.1.15627 WP_000332219.1.15644 WP_000332219.1.15784 WP_000332219.1.15830 WP_000332219.1.15835 WP_000332219.1.15881 WP_000332219.1.15909 WP_000332219.1.1592 WP_000332219.1.15978 WP_000332219.1.15995 WP_000332219.1.1601 WP_000332219.1.16028 WP_000332219.1.16032 WP_000332219.1.16052 WP_000332219.1.16062 WP_000332219.1.16063 WP_000332219.1.16103 WP_000332219.1.1611 WP_000332219.1.16158 WP_000332219.1.16166 WP_000332219.1.16172 WP_000332219.1.16226 WP_000332219.1.16233 WP_000332219.1.16244 WP_000332219.1.16284 WP_000332219.1.16328 WP_000332219.1.1635 WP_000332219.1.16468 WP_000332219.1.16508 WP_000332219.1.16551 WP_000332219.1.16565 WP_000332219.1.16581 WP_000332219.1.16614 WP_000332219.1.16650 WP_000332219.1.16656 WP_000332219.1.1668 WP_000332219.1.16686 WP_000332219.1.16691 WP_000332219.1.167 WP_000332219.1.16732 WP_000332219.1.16735 WP_000332219.1.16826 WP_000332219.1.16858 WP_000332219.1.1689 WP_000332219.1.16896 WP_000332219.1.16910 WP_000332219.1.16916 WP_000332219.1.16942 WP_000332219.1.16944 WP_000332219.1.16965 WP_000332219.1.16998 WP_000332219.1.1700 WP_000332219.1.17031 WP_000332219.1.17188 WP_000332219.1.17307 WP_000332219.1.174 WP_000332219.1.17480 WP_000332219.1.17546 WP_000332219.1.1757 WP_000332219.1.17629 WP_000332219.1.17693 WP_000332219.1.17702 WP_000332219.1.17703 WP_000332219.1.17705 WP_000332219.1.17755 WP_000332219.1.17919 WP_000332219.1.17949 WP_000332219.1.18019 WP_000332219.1.1807 WP_000332219.1.18089 WP_000332219.1.18111 WP_000332219.1.1814 WP_000332219.1.18163 WP_000332219.1.18177 WP_000332219.1.18178 WP_000332219.1.18192 WP_000332219.1.1825 WP_000332219.1.18265 WP_000332219.1.18267 WP_000332219.1.18282 WP_000332219.1.18365 WP_000332219.1.18426 WP_000332219.1.18445 WP_000332219.1.18468 WP_000332219.1.18607 WP_000332219.1.18705 WP_000332219.1.18715 WP_000332219.1.18776 WP_000332219.1.18822 WP_000332219.1.18881 WP_000332219.1.18919 WP_000332219.1.18940 WP_000332219.1.18949 WP_000332219.1.19030 WP_000332219.1.19038 WP_000332219.1.19053 WP_000332219.1.19055 WP_000332219.1.19240 WP_000332219.1.19320 WP_000332219.1.19340 WP_000332219.1.19357 WP_000332219.1.1939 WP_000332219.1.19458 WP_000332219.1.19460 WP_000332219.1.19461 WP_000332219.1.19469 WP_000332219.1.1954 WP_000332219.1.19614 WP_000332219.1.19642 WP_000332219.1.1968 WP_000332219.1.19683 WP_000332219.1.19702 WP_000332219.1.19706 WP_000332219.1.19724 WP_000332219.1.19740 WP_000332219.1.19784 WP_000332219.1.19802 WP_000332219.1.19809 WP_000332219.1.19823 WP_000332219.1.19851 WP_000332219.1.19867 WP_000332219.1.19884 WP_000332219.1.1990 WP_000332219.1.1998 WP_000332219.1.19987 WP_000332219.1.20 WP_000332219.1.20023 WP_000332219.1.20081 WP_000332219.1.20089 WP_000332219.1.2010 WP_000332219.1.20119 WP_000332219.1.20212 WP_000332219.1.20218 WP_000332219.1.20266 WP_000332219.1.20271 WP_000332219.1.20330 WP_000332219.1.20362 WP_000332219.1.20415 WP_000332219.1.20418 WP_000332219.1.20443 WP_000332219.1.20488 WP_000332219.1.20503 WP_000332219.1.20525 WP_000332219.1.2054 WP_000332219.1.20553 WP_000332219.1.20573 WP_000332219.1.20626 WP_000332219.1.20646 WP_000332219.1.20700 WP_000332219.1.20760 WP_000332219.1.20795 WP_000332219.1.20862 WP_000332219.1.20886 WP_000332219.1.20900 WP_000332219.1.20908 WP_000332219.1.2101 WP_000332219.1.21049 WP_000332219.1.21075 WP_000332219.1.21086 WP_000332219.1.21089 WP_000332219.1.21146 WP_000332219.1.21165 WP_000332219.1.21245 WP_000332219.1.21246 WP_000332219.1.21269 WP_000332219.1.21400 WP_000332219.1.21404 WP_000332219.1.2146 WP_000332219.1.21497 WP_000332219.1.21499 WP_000332219.1.21603 WP_000332219.1.21692 WP_000332219.1.21730 WP_000332219.1.21750 WP_000332219.1.21751 WP_000332219.1.21757 WP_000332219.1.21825 WP_000332219.1.21845 WP_000332219.1.21877 WP_000332219.1.21886 WP_000332219.1.21940 WP_000332219.1.21981 WP_000332219.1.22019 WP_000332219.1.22024 WP_000332219.1.22030 WP_000332219.1.2205 WP_000332219.1.22062 WP_000332219.1.22067 WP_000332219.1.22069 WP_000332219.1.22117 WP_000332219.1.2221 WP_000332219.1.22315 WP_000332219.1.22323 WP_000332219.1.22337 WP_000332219.1.2235 WP_000332219.1.22379 WP_000332219.1.22427 WP_000332219.1.22453 WP_000332219.1.2246 WP_000332219.1.22485 WP_000332219.1.22537 WP_000332219.1.22604 WP_000332219.1.22620 WP_000332219.1.22623 WP_000332219.1.22676 WP_000332219.1.2283 WP_000332219.1.22845 WP_000332219.1.22870 WP_000332219.1.22979 WP_000332219.1.23010 WP_000332219.1.23053 WP_000332219.1.23080 WP_000332219.1.23102 WP_000332219.1.23114 WP_000332219.1.2314 WP_000332219.1.23148 WP_000332219.1.23192 WP_000332219.1.23258 WP_000332219.1.23259 WP_000332219.1.23274 WP_000332219.1.23279 WP_000332219.1.23444 WP_000332219.1.23460 WP_000332219.1.23472 WP_000332219.1.23482 WP_000332219.1.23485 WP_000332219.1.23503 WP_000332219.1.23513 WP_000332219.1.23587 WP_000332219.1.23629 WP_000332219.1.23634 WP_000332219.1.23639 WP_000332219.1.2364 WP_000332219.1.23646 WP_000332219.1.23675 WP_000332219.1.2376 WP_000332219.1.23819 WP_000332219.1.23932 WP_000332219.1.24158 WP_000332219.1.24206 WP_000332219.1.24259 WP_000332219.1.24308 WP_000332219.1.24376 WP_000332219.1.24392 WP_000332219.1.24450 WP_000332219.1.24555 WP_000332219.1.24578 WP_000332219.1.24689 WP_000332219.1.24696 WP_000332219.1.24737 WP_000332219.1.24779 WP_000332219.1.24837 WP_000332219.1.24873 WP_000332219.1.24995 WP_000332219.1.25008 WP_000332219.1.25015 WP_000332219.1.25036 WP_000332219.1.25130 WP_000332219.1.25205 WP_000332219.1.25206 WP_000332219.1.25229 WP_000332219.1.2525 WP_000332219.1.25405 WP_000332219.1.25454 WP_000332219.1.25493 WP_000332219.1.25514 WP_000332219.1.25546 WP_000332219.1.25564 WP_000332219.1.25668 WP_000332219.1.25690 WP_000332219.1.2570 WP_000332219.1.25700 WP_000332219.1.25703 WP_000332219.1.25740 WP_000332219.1.25793 WP_000332219.1.25809 WP_000332219.1.25814 WP_000332219.1.25825 WP_000332219.1.25928 WP_000332219.1.25932 WP_000332219.1.25988 WP_000332219.1.26034 WP_000332219.1.26093 WP_000332219.1.26123 WP_000332219.1.26129 WP_000332219.1.26213 WP_000332219.1.26224 WP_000332219.1.26282 WP_000332219.1.26311 WP_000332219.1.26319 WP_000332219.1.26384 WP_000332219.1.26429 WP_000332219.1.26493 WP_000332219.1.26551 WP_000332219.1.26567 WP_000332219.1.26646 WP_000332219.1.2667 WP_000332219.1.26709 WP_000332219.1.26787 WP_000332219.1.26856 WP_000332219.1.26882 WP_000332219.1.26883 WP_000332219.1.26980 WP_000332219.1.27010 WP_000332219.1.27051 WP_000332219.1.27055 WP_000332219.1.27072 WP_000332219.1.27173 WP_000332219.1.272 WP_000332219.1.27206 WP_000332219.1.2723 WP_000332219.1.27255 WP_000332219.1.27342 WP_000332219.1.27423 WP_000332219.1.27452 WP_000332219.1.27513 WP_000332219.1.27523 WP_000332219.1.27561 WP_000332219.1.27616 WP_000332219.1.2763 WP_000332219.1.27655 WP_000332219.1.27665 WP_000332219.1.27707 WP_000332219.1.27755 WP_000332219.1.27761 WP_000332219.1.2777 WP_000332219.1.27776 WP_000332219.1.27798 WP_000332219.1.27815 WP_000332219.1.27857 WP_000332219.1.27977 WP_000332219.1.28002 WP_000332219.1.28094 WP_000332219.1.28126 WP_000332219.1.28170 WP_000332219.1.28225 WP_000332219.1.28235 WP_000332219.1.2825 WP_000332219.1.28267 WP_000332219.1.28301 WP_000332219.1.28302 WP_000332219.1.2835 WP_000332219.1.28370 WP_000332219.1.28393 WP_000332219.1.28538 WP_000332219.1.28575 WP_000332219.1.28625 WP_000332219.1.28655 WP_000332219.1.28694 WP_000332219.1.287 WP_000332219.1.28775 WP_000332219.1.2879 WP_000332219.1.28811 WP_000332219.1.28830 WP_000332219.1.2890 WP_000332219.1.28902 WP_000332219.1.28938 WP_000332219.1.28946 WP_000332219.1.28948 WP_000332219.1.28977 WP_000332219.1.29006 WP_000332219.1.29010 WP_000332219.1.2910 WP_000332219.1.29130 WP_000332219.1.29190 WP_000332219.1.29349 WP_000332219.1.29454 WP_000332219.1.29588 WP_000332219.1.29601 WP_000332219.1.29606 WP_000332219.1.29615 WP_000332219.1.29619 WP_000332219.1.29704 WP_000332219.1.29732 WP_000332219.1.29774 WP_000332219.1.29775 WP_000332219.1.2984 WP_000332219.1.29845 WP_000332219.1.29923 WP_000332219.1.29969 WP_000332219.1.30006 WP_000332219.1.30018 WP_000332219.1.30027 WP_000332219.1.30086 WP_000332219.1.3017 WP_000332219.1.30179 WP_000332219.1.30180 WP_000332219.1.30238 WP_000332219.1.30331 WP_000332219.1.30386 WP_000332219.1.30469 WP_000332219.1.30505 WP_000332219.1.30507 WP_000332219.1.30535 WP_000332219.1.30547 WP_000332219.1.30602 WP_000332219.1.3066 WP_000332219.1.3068 WP_000332219.1.30696 WP_000332219.1.30794 WP_000332219.1.3080 WP_000332219.1.30803 WP_000332219.1.30819 WP_000332219.1.30833 WP_000332219.1.30835 WP_000332219.1.30934 WP_000332219.1.30972 WP_000332219.1.31 WP_000332219.1.31001 WP_000332219.1.31086 WP_000332219.1.31111 WP_000332219.1.3113 WP_000332219.1.3114 WP_000332219.1.31155 WP_000332219.1.31185 WP_000332219.1.3119 WP_000332219.1.31190 WP_000332219.1.31195 WP_000332219.1.31196 WP_000332219.1.31214 WP_000332219.1.31219 WP_000332219.1.31222 WP_000332219.1.3124 WP_000332219.1.31251 WP_000332219.1.3127 WP_000332219.1.31281 WP_000332219.1.31362 WP_000332219.1.31504 WP_000332219.1.31515 WP_000332219.1.31578 WP_000332219.1.31658 WP_000332219.1.31665 WP_000332219.1.3170 WP_000332219.1.31725 WP_000332219.1.31782 WP_000332219.1.31845 WP_000332219.1.31854 WP_000332219.1.31927 WP_000332219.1.31940 WP_000332219.1.31967 WP_000332219.1.31972 WP_000332219.1.32006 WP_000332219.1.32192 WP_000332219.1.32206 WP_000332219.1.32408 WP_000332219.1.32423 WP_000332219.1.32424 WP_000332219.1.32438 WP_000332219.1.32491 WP_000332219.1.32515 WP_000332219.1.32527 WP_000332219.1.32624 WP_000332219.1.32629 WP_000332219.1.32660 WP_000332219.1.32702 WP_000332219.1.32714 WP_000332219.1.32750 WP_000332219.1.3278 WP_000332219.1.32786 WP_000332219.1.32804 WP_000332219.1.32860 WP_000332219.1.32900 WP_000332219.1.32902 WP_000332219.1.32907 WP_000332219.1.32961 WP_000332219.1.33030 WP_000332219.1.3304 WP_000332219.1.33106 WP_000332219.1.33127 WP_000332219.1.33143 WP_000332219.1.33144 WP_000332219.1.33248 WP_000332219.1.33261 WP_000332219.1.333 WP_000332219.1.33392 WP_000332219.1.33486 WP_000332219.1.33492 WP_000332219.1.33553 WP_000332219.1.33592 WP_000332219.1.33629 WP_000332219.1.33659 WP_000332219.1.33870 WP_000332219.1.33894 WP_000332219.1.33986 WP_000332219.1.34043 WP_000332219.1.34075 WP_000332219.1.34081 WP_000332219.1.34084 WP_000332219.1.34107 WP_000332219.1.34126 WP_000332219.1.34257 WP_000332219.1.34279 WP_000332219.1.34304 WP_000332219.1.34319 WP_000332219.1.34330 WP_000332219.1.3445 WP_000332219.1.34453 WP_000332219.1.34458 WP_000332219.1.34610 WP_000332219.1.3476 WP_000332219.1.34854 WP_000332219.1.34856 WP_000332219.1.34881 WP_000332219.1.34972 WP_000332219.1.34975 WP_000332219.1.34977 WP_000332219.1.35035 WP_000332219.1.35045 WP_000332219.1.35075 WP_000332219.1.35129 WP_000332219.1.35184 WP_000332219.1.35404 WP_000332219.1.35408 WP_000332219.1.3541 WP_000332219.1.35425 WP_000332219.1.35429 WP_000332219.1.35446 WP_000332219.1.35463 WP_000332219.1.35494 WP_000332219.1.35503 WP_000332219.1.35509 WP_000332219.1.35590 WP_000332219.1.35648 WP_000332219.1.35777 WP_000332219.1.35809 WP_000332219.1.35835 WP_000332219.1.35940 WP_000332219.1.35993 WP_000332219.1.36003 WP_000332219.1.3601 WP_000332219.1.36011 WP_000332219.1.3610 WP_000332219.1.36172 WP_000332219.1.36229 WP_000332219.1.36232 WP_000332219.1.36286 WP_000332219.1.36512 WP_000332219.1.36542 WP_000332219.1.36609 WP_000332219.1.36690 WP_000332219.1.3670 WP_000332219.1.36705 WP_000332219.1.3688 WP_000332219.1.36885 WP_000332219.1.36899 WP_000332219.1.36918 WP_000332219.1.36931 WP_000332219.1.36949 WP_000332219.1.36978 WP_000332219.1.37013 WP_000332219.1.37021 WP_000332219.1.37073 WP_000332219.1.37111 WP_000332219.1.37112 WP_000332219.1.37147 WP_000332219.1.37158 WP_000332219.1.37256 WP_000332219.1.37267 WP_000332219.1.3728 WP_000332219.1.37293 WP_000332219.1.37320 WP_000332219.1.37370 WP_000332219.1.37376 WP_000332219.1.3744 WP_000332219.1.37478 WP_000332219.1.37498 WP_000332219.1.37504 WP_000332219.1.37521 WP_000332219.1.3756 WP_000332219.1.37610 WP_000332219.1.37618 WP_000332219.1.37666 WP_000332219.1.37687 WP_000332219.1.37719 WP_000332219.1.37848 WP_000332219.1.37965 WP_000332219.1.37968 WP_000332219.1.37978 WP_000332219.1.38055 WP_000332219.1.38113 WP_000332219.1.38125 WP_000332219.1.38145 WP_000332219.1.3828 WP_000332219.1.383 WP_000332219.1.38341 WP_000332219.1.3848 WP_000332219.1.38609 WP_000332219.1.38613 WP_000332219.1.38673 WP_000332219.1.3869 WP_000332219.1.38693 WP_000332219.1.38740 WP_000332219.1.38773 WP_000332219.1.38797 WP_000332219.1.38881 WP_000332219.1.38882 WP_000332219.1.38895 WP_000332219.1.38898 WP_000332219.1.38913 WP_000332219.1.38995 WP_000332219.1.39003 WP_000332219.1.39082 WP_000332219.1.39113 WP_000332219.1.39136 WP_000332219.1.39140 WP_000332219.1.39197 WP_000332219.1.39229 WP_000332219.1.39311 WP_000332219.1.39405 WP_000332219.1.39420 WP_000332219.1.39449 WP_000332219.1.39466 WP_000332219.1.39471 WP_000332219.1.39497 WP_000332219.1.39503 WP_000332219.1.39512 WP_000332219.1.39553 WP_000332219.1.39556 WP_000332219.1.39609 WP_000332219.1.39629 WP_000332219.1.39722 WP_000332219.1.39763 WP_000332219.1.39862 WP_000332219.1.39921 WP_000332219.1.39923 WP_000332219.1.40017 WP_000332219.1.40072 WP_000332219.1.40073 WP_000332219.1.4011 WP_000332219.1.40155 WP_000332219.1.40171 WP_000332219.1.40205 WP_000332219.1.40208 WP_000332219.1.40229 WP_000332219.1.40240 WP_000332219.1.40257 WP_000332219.1.40258 WP_000332219.1.40292 WP_000332219.1.40305 WP_000332219.1.40311 WP_000332219.1.40380 WP_000332219.1.40395 WP_000332219.1.40465 WP_000332219.1.40492 WP_000332219.1.40508 WP_000332219.1.40583 WP_000332219.1.40710 WP_000332219.1.4075 WP_000332219.1.40771 WP_000332219.1.40788 WP_000332219.1.4087 WP_000332219.1.40877 WP_000332219.1.40910 WP_000332219.1.40979 WP_000332219.1.41017 WP_000332219.1.41048 WP_000332219.1.41050 WP_000332219.1.41086 WP_000332219.1.4109 WP_000332219.1.41091 WP_000332219.1.41225 WP_000332219.1.41226 WP_000332219.1.41265 WP_000332219.1.41279 WP_000332219.1.41299 WP_000332219.1.41308 WP_000332219.1.41310 WP_000332219.1.41345 WP_000332219.1.41375 WP_000332219.1.41438 WP_000332219.1.41440 WP_000332219.1.41516 WP_000332219.1.41554 WP_000332219.1.41572 WP_000332219.1.41591 WP_000332219.1.41593 WP_000332219.1.41628 WP_000332219.1.41662 WP_000332219.1.41708 WP_000332219.1.41724 WP_000332219.1.41761 WP_000332219.1.41789 WP_000332219.1.4184 WP_000332219.1.41859 WP_000332219.1.41862 WP_000332219.1.41877 WP_000332219.1.41882 WP_000332219.1.41931 WP_000332219.1.41979 WP_000332219.1.41985 WP_000332219.1.41994 WP_000332219.1.42009 WP_000332219.1.42104 WP_000332219.1.42238 WP_000332219.1.42276 WP_000332219.1.42320 WP_000332219.1.42328 WP_000332219.1.4239 WP_000332219.1.42404 WP_000332219.1.42422 WP_000332219.1.42453 WP_000332219.1.42491 WP_000332219.1.4257 WP_000332219.1.42707 WP_000332219.1.4276 WP_000332219.1.42864 WP_000332219.1.4288 WP_000332219.1.4289 WP_000332219.1.42981 WP_000332219.1.43018 WP_000332219.1.43041 WP_000332219.1.43086 WP_000332219.1.43244 WP_000332219.1.43272 WP_000332219.1.43276 WP_000332219.1.43299 WP_000332219.1.43312 WP_000332219.1.4332 WP_000332219.1.43334 WP_000332219.1.43351 WP_000332219.1.43437 WP_000332219.1.43438 WP_000332219.1.43441 WP_000332219.1.43522 WP_000332219.1.43528 WP_000332219.1.43613 WP_000332219.1.43668 WP_000332219.1.43676 WP_000332219.1.43710 WP_000332219.1.4373 WP_000332219.1.43828 WP_000332219.1.43864 WP_000332219.1.43873 WP_000332219.1.43886 WP_000332219.1.44005 WP_000332219.1.4404 WP_000332219.1.44043 WP_000332219.1.44099 WP_000332219.1.44121 WP_000332219.1.44191 WP_000332219.1.44250 WP_000332219.1.44291 WP_000332219.1.44310 WP_000332219.1.44359 WP_000332219.1.44380 WP_000332219.1.44386 WP_000332219.1.4440 WP_000332219.1.44453 WP_000332219.1.44479 WP_000332219.1.44593 WP_000332219.1.44607 WP_000332219.1.44636 WP_000332219.1.44640 WP_000332219.1.4467 WP_000332219.1.44702 WP_000332219.1.44747 WP_000332219.1.44791 WP_000332219.1.44877 WP_000332219.1.449 WP_000332219.1.44927 WP_000332219.1.44971 WP_000332219.1.44996 WP_000332219.1.45027 WP_000332219.1.45038 WP_000332219.1.45067 WP_000332219.1.45074 WP_000332219.1.45079 WP_000332219.1.45098 WP_000332219.1.45123 WP_000332219.1.45134 WP_000332219.1.45138 WP_000332219.1.45154 WP_000332219.1.45177 WP_000332219.1.45184 WP_000332219.1.45251 WP_000332219.1.45259 WP_000332219.1.45322 WP_000332219.1.45344 WP_000332219.1.45349 WP_000332219.1.45351 WP_000332219.1.45365 WP_000332219.1.4540 WP_000332219.1.45522 WP_000332219.1.45550 WP_000332219.1.45585 WP_000332219.1.45660 WP_000332219.1.45690 WP_000332219.1.45781 WP_000332219.1.45797 WP_000332219.1.458 WP_000332219.1.46011 WP_000332219.1.46069 WP_000332219.1.46112 WP_000332219.1.46174 WP_000332219.1.46187 WP_000332219.1.46205 WP_000332219.1.46232 WP_000332219.1.46243 WP_000332219.1.46303 WP_000332219.1.46323 WP_000332219.1.46358 WP_000332219.1.46499 WP_000332219.1.46572 WP_000332219.1.46595 WP_000332219.1.46620 WP_000332219.1.46637 WP_000332219.1.46675 WP_000332219.1.46693 WP_000332219.1.46732 WP_000332219.1.46749 WP_000332219.1.46804 WP_000332219.1.46930 WP_000332219.1.46975 WP_000332219.1.47005 WP_000332219.1.47057 WP_000332219.1.47067 WP_000332219.1.47214 WP_000332219.1.47429 WP_000332219.1.47442 WP_000332219.1.47448 WP_000332219.1.47460 WP_000332219.1.4747 WP_000332219.1.47472 WP_000332219.1.47478 WP_000332219.1.47492 WP_000332219.1.47506 WP_000332219.1.47614 WP_000332219.1.47621 WP_000332219.1.4769 WP_000332219.1.4770 WP_000332219.1.4775 WP_000332219.1.47767 WP_000332219.1.47799 WP_000332219.1.47817 WP_000332219.1.47849 WP_000332219.1.47902 WP_000332219.1.47928 WP_000332219.1.47992 WP_000332219.1.48215 WP_000332219.1.48218 WP_000332219.1.48242 WP_000332219.1.48244 WP_000332219.1.48247 WP_000332219.1.48253 WP_000332219.1.483 WP_000332219.1.48367 WP_000332219.1.48377 WP_000332219.1.48399 WP_000332219.1.4853 WP_000332219.1.48751 WP_000332219.1.48755 WP_000332219.1.48774 WP_000332219.1.48788 WP_000332219.1.4885 WP_000332219.1.48855 WP_000332219.1.48876 WP_000332219.1.48894 WP_000332219.1.48896 WP_000332219.1.48908 WP_000332219.1.48919 WP_000332219.1.49005 WP_000332219.1.49012 WP_000332219.1.49084 WP_000332219.1.49155 WP_000332219.1.49175 WP_000332219.1.49204 WP_000332219.1.49214 WP_000332219.1.49239 WP_000332219.1.49256 WP_000332219.1.49262 WP_000332219.1.49290 WP_000332219.1.49340 WP_000332219.1.49366 WP_000332219.1.49375 WP_000332219.1.49490 WP_000332219.1.49515 WP_000332219.1.49572 WP_000332219.1.49574 WP_000332219.1.49595 WP_000332219.1.49602 WP_000332219.1.49647 WP_000332219.1.49778 WP_000332219.1.4979 WP_000332219.1.49803 WP_000332219.1.49805 WP_000332219.1.49929 WP_000332219.1.50080 WP_000332219.1.50161 WP_000332219.1.50211 WP_000332219.1.50251 WP_000332219.1.50374 WP_000332219.1.50376 WP_000332219.1.50386 WP_000332219.1.50389 WP_000332219.1.50413 WP_000332219.1.50478 WP_000332219.1.50576 WP_000332219.1.5058 WP_000332219.1.50593 WP_000332219.1.50676 WP_000332219.1.50774 WP_000332219.1.50800 WP_000332219.1.50804 WP_000332219.1.50808 WP_000332219.1.50811 WP_000332219.1.5088 WP_000332219.1.50908 WP_000332219.1.50918 WP_000332219.1.50941 WP_000332219.1.50954 WP_000332219.1.51014 WP_000332219.1.51022 WP_000332219.1.51036 WP_000332219.1.51131 WP_000332219.1.5114 WP_000332219.1.51178 WP_000332219.1.51179 WP_000332219.1.51182 WP_000332219.1.51186 WP_000332219.1.5125 WP_000332219.1.51331 WP_000332219.1.51338 WP_000332219.1.5138 WP_000332219.1.51394 WP_000332219.1.51419 WP_000332219.1.51487 WP_000332219.1.51488 WP_000332219.1.51506 WP_000332219.1.51613 WP_000332219.1.51634 WP_000332219.1.51649 WP_000332219.1.51686 WP_000332219.1.51700 WP_000332219.1.51704 WP_000332219.1.51756 WP_000332219.1.51910 WP_000332219.1.51911 WP_000332219.1.51914 WP_000332219.1.51932 WP_000332219.1.51989 WP_000332219.1.52047 WP_000332219.1.52121 WP_000332219.1.52148 WP_000332219.1.52156 WP_000332219.1.52161 WP_000332219.1.52255 WP_000332219.1.52346 WP_000332219.1.52353 WP_000332219.1.52361 WP_000332219.1.52446 WP_000332219.1.52608 WP_000332219.1.52637 WP_000332219.1.52653 WP_000332219.1.52656 WP_000332219.1.52738 WP_000332219.1.52743 WP_000332219.1.52744 WP_000332219.1.52824 WP_000332219.1.52851 WP_000332219.1.52857 WP_000332219.1.52898 WP_000332219.1.52915 WP_000332219.1.52924 WP_000332219.1.53100 WP_000332219.1.53158 WP_000332219.1.53190 WP_000332219.1.53315 WP_000332219.1.53406 WP_000332219.1.53436 WP_000332219.1.53466 WP_000332219.1.53529 WP_000332219.1.53543 WP_000332219.1.53675 WP_000332219.1.53696 WP_000332219.1.53757 WP_000332219.1.53772 WP_000332219.1.53790 WP_000332219.1.53812 WP_000332219.1.53814 WP_000332219.1.5392 WP_000332219.1.54033 WP_000332219.1.54075 WP_000332219.1.54085 WP_000332219.1.5415 WP_000332219.1.54159 WP_000332219.1.54196 WP_000332219.1.542 WP_000332219.1.54209 WP_000332219.1.54271 WP_000332219.1.54273 WP_000332219.1.54319 WP_000332219.1.54324 WP_000332219.1.54333 WP_000332219.1.54364 WP_000332219.1.54400 WP_000332219.1.54522 WP_000332219.1.5456 WP_000332219.1.54607 WP_000332219.1.54644 WP_000332219.1.54662 WP_000332219.1.54694 WP_000332219.1.54722 WP_000332219.1.54749 WP_000332219.1.54764 WP_000332219.1.54774 WP_000332219.1.54814 WP_000332219.1.54822 WP_000332219.1.54845 WP_000332219.1.5485 WP_000332219.1.54984 WP_000332219.1.54992 WP_000332219.1.55008 WP_000332219.1.55073 WP_000332219.1.55152 WP_000332219.1.55156 WP_000332219.1.55166 WP_000332219.1.55178 WP_000332219.1.55224 WP_000332219.1.5523 WP_000332219.1.5525 WP_000332219.1.55285 WP_000332219.1.55294 WP_000332219.1.55418 WP_000332219.1.55461 WP_000332219.1.55475 WP_000332219.1.5552 WP_000332219.1.55528 WP_000332219.1.5555 WP_000332219.1.55554 WP_000332219.1.55557 WP_000332219.1.55614 WP_000332219.1.55623 WP_000332219.1.55647 WP_000332219.1.55680 WP_000332219.1.55706 WP_000332219.1.55743 WP_000332219.1.55768 WP_000332219.1.55782 WP_000332219.1.55796 WP_000332219.1.55803 WP_000332219.1.55993 WP_000332219.1.55995 WP_000332219.1.56002 WP_000332219.1.56004 WP_000332219.1.56012 WP_000332219.1.56026 WP_000332219.1.56059 WP_000332219.1.56097 WP_000332219.1.56100 WP_000332219.1.56105 WP_000332219.1.56286 WP_000332219.1.56303 WP_000332219.1.56304 WP_000332219.1.5633 WP_000332219.1.56354 WP_000332219.1.56368 WP_000332219.1.56370 WP_000332219.1.56385 WP_000332219.1.56396 WP_000332219.1.56414 WP_000332219.1.56438 WP_000332219.1.56468 WP_000332219.1.56512 WP_000332219.1.56560 WP_000332219.1.56597 WP_000332219.1.56601 WP_000332219.1.56614 WP_000332219.1.56615 WP_000332219.1.56642 WP_000332219.1.56647 WP_000332219.1.56651 WP_000332219.1.56671 WP_000332219.1.56682 WP_000332219.1.56824 WP_000332219.1.56875 WP_000332219.1.56877 WP_000332219.1.57000 WP_000332219.1.57076 WP_000332219.1.57125 WP_000332219.1.57168 WP_000332219.1.57187 WP_000332219.1.57232 WP_000332219.1.57344 WP_000332219.1.57377 WP_000332219.1.57418 WP_000332219.1.57433 WP_000332219.1.57515 WP_000332219.1.57521 WP_000332219.1.57529 WP_000332219.1.5753 WP_000332219.1.57555 WP_000332219.1.57576 WP_000332219.1.57601 WP_000332219.1.57607 WP_000332219.1.57710 WP_000332219.1.57763 WP_000332219.1.57778 WP_000332219.1.57797 WP_000332219.1.5781 WP_000332219.1.57862 WP_000332219.1.57890 WP_000332219.1.57891 WP_000332219.1.57978 WP_000332219.1.5801 WP_000332219.1.58041 WP_000332219.1.58131 WP_000332219.1.58157 WP_000332219.1.58239 WP_000332219.1.58251 WP_000332219.1.58357 WP_000332219.1.58372 WP_000332219.1.58416 WP_000332219.1.58418 WP_000332219.1.58442 WP_000332219.1.5854 WP_000332219.1.58548 WP_000332219.1.5858 WP_000332219.1.58604 WP_000332219.1.58662 WP_000332219.1.58669 WP_000332219.1.58729 WP_000332219.1.58744 WP_000332219.1.58745 WP_000332219.1.58803 WP_000332219.1.58831 WP_000332219.1.58834 WP_000332219.1.58836 WP_000332219.1.5886 WP_000332219.1.58861 WP_000332219.1.59006 WP_000332219.1.59094 WP_000332219.1.59097 WP_000332219.1.59136 WP_000332219.1.59148 WP_000332219.1.59224 WP_000332219.1.5929 WP_000332219.1.59295 WP_000332219.1.59321 WP_000332219.1.59375 WP_000332219.1.59458 WP_000332219.1.59490 WP_000332219.1.59508 WP_000332219.1.59512 WP_000332219.1.59521 WP_000332219.1.5953 WP_000332219.1.59684 WP_000332219.1.59694 WP_000332219.1.59710 WP_000332219.1.59771 WP_000332219.1.5979 WP_000332219.1.59953 WP_000332219.1.59979 WP_000332219.1.60008 WP_000332219.1.60021 WP_000332219.1.60052 WP_000332219.1.60069 WP_000332219.1.60106 WP_000332219.1.60140 WP_000332219.1.60155 WP_000332219.1.60209 WP_000332219.1.60213 WP_000332219.1.60226 WP_000332219.1.60231 WP_000332219.1.60285 WP_000332219.1.60370 WP_000332219.1.60379 WP_000332219.1.60464 WP_000332219.1.60469 WP_000332219.1.60503 WP_000332219.1.60507 WP_000332219.1.60597 WP_000332219.1.60608 WP_000332219.1.60622 WP_000332219.1.60760 WP_000332219.1.60794 WP_000332219.1.60851 WP_000332219.1.60857 WP_000332219.1.60863 WP_000332219.1.60874 WP_000332219.1.60941 WP_000332219.1.61045 WP_000332219.1.61078 WP_000332219.1.6108 WP_000332219.1.61087 WP_000332219.1.61114 WP_000332219.1.6114 WP_000332219.1.61146 WP_000332219.1.61201 WP_000332219.1.61218 WP_000332219.1.61232 WP_000332219.1.6129 WP_000332219.1.61296 WP_000332219.1.61345 WP_000332219.1.61417 WP_000332219.1.61509 WP_000332219.1.61519 WP_000332219.1.61574 WP_000332219.1.61609 WP_000332219.1.61662 WP_000332219.1.61667 WP_000332219.1.61712 WP_000332219.1.61714 WP_000332219.1.61730 WP_000332219.1.61732 WP_000332219.1.61783 WP_000332219.1.61857 WP_000332219.1.61918 WP_000332219.1.61952 WP_000332219.1.62007 WP_000332219.1.62025 WP_000332219.1.62076 WP_000332219.1.62108 WP_000332219.1.62144 WP_000332219.1.62204 WP_000332219.1.62219 WP_000332219.1.62222 WP_000332219.1.62241 WP_000332219.1.62271 WP_000332219.1.62304 WP_000332219.1.62339 WP_000332219.1.62361 WP_000332219.1.62364 WP_000332219.1.62374 WP_000332219.1.62403 WP_000332219.1.6253 WP_000332219.1.62564 WP_000332219.1.62570 WP_000332219.1.62677 WP_000332219.1.62693 WP_000332219.1.62798 WP_000332219.1.62853 WP_000332219.1.62903 WP_000332219.1.62910 WP_000332219.1.62955 WP_000332219.1.63063 WP_000332219.1.63118 WP_000332219.1.63135 WP_000332219.1.63150 WP_000332219.1.63181 WP_000332219.1.63186 WP_000332219.1.63203 WP_000332219.1.63243 WP_000332219.1.63256 WP_000332219.1.63290 WP_000332219.1.63382 WP_000332219.1.63422 WP_000332219.1.63432 WP_000332219.1.63479 WP_000332219.1.63499 WP_000332219.1.63513 WP_000332219.1.63532 WP_000332219.1.63577 WP_000332219.1.63664 WP_000332219.1.63690 WP_000332219.1.63718 WP_000332219.1.63731 WP_000332219.1.6375 WP_000332219.1.63757 WP_000332219.1.63766 WP_000332219.1.63782 WP_000332219.1.63834 WP_000332219.1.63860 WP_000332219.1.63866 WP_000332219.1.63912 WP_000332219.1.63958 WP_000332219.1.64034 WP_000332219.1.64046 WP_000332219.1.64072 WP_000332219.1.64208 WP_000332219.1.6423 WP_000332219.1.64244 WP_000332219.1.64374 WP_000332219.1.64403 WP_000332219.1.6451 WP_000332219.1.64645 WP_000332219.1.64649 WP_000332219.1.64674 WP_000332219.1.64690 WP_000332219.1.64702 WP_000332219.1.64757 WP_000332219.1.64781 WP_000332219.1.64831 WP_000332219.1.6489 WP_000332219.1.64919 WP_000332219.1.64920 WP_000332219.1.64977 WP_000332219.1.65018 WP_000332219.1.65028 WP_000332219.1.65168 WP_000332219.1.65171 WP_000332219.1.65238 WP_000332219.1.65248 WP_000332219.1.6525 WP_000332219.1.6535 WP_000332219.1.65394 WP_000332219.1.65474 WP_000332219.1.65508 WP_000332219.1.65538 WP_000332219.1.65633 WP_000332219.1.6565 WP_000332219.1.65696 WP_000332219.1.6575 WP_000332219.1.65782 WP_000332219.1.6594 WP_000332219.1.65968 WP_000332219.1.66085 WP_000332219.1.66129 WP_000332219.1.66250 WP_000332219.1.66272 WP_000332219.1.6630 WP_000332219.1.66314 WP_000332219.1.66358 WP_000332219.1.66362 WP_000332219.1.66365 WP_000332219.1.6638 WP_000332219.1.6640 WP_000332219.1.66492 WP_000332219.1.66600 WP_000332219.1.66698 WP_000332219.1.66702 WP_000332219.1.66779 WP_000332219.1.6680 WP_000332219.1.66834 WP_000332219.1.66876 WP_000332219.1.66901 WP_000332219.1.66962 WP_000332219.1.67 WP_000332219.1.67037 WP_000332219.1.67045 WP_000332219.1.67175 WP_000332219.1.67181 WP_000332219.1.67268 WP_000332219.1.67347 WP_000332219.1.67424 WP_000332219.1.67465 WP_000332219.1.67552 WP_000332219.1.67603 WP_000332219.1.67637 WP_000332219.1.67682 WP_000332219.1.67707 WP_000332219.1.67731 WP_000332219.1.67803 WP_000332219.1.67814 WP_000332219.1.67827 WP_000332219.1.67829 WP_000332219.1.6785 WP_000332219.1.67887 WP_000332219.1.67905 WP_000332219.1.67942 WP_000332219.1.67969 WP_000332219.1.67970 WP_000332219.1.67977 WP_000332219.1.68036 WP_000332219.1.68073 WP_000332219.1.6809 WP_000332219.1.68115 WP_000332219.1.68147 WP_000332219.1.68201 WP_000332219.1.68206 WP_000332219.1.68210 WP_000332219.1.6827 WP_000332219.1.68275 WP_000332219.1.68478 WP_000332219.1.6849 WP_000332219.1.685 WP_000332219.1.68547 WP_000332219.1.6857 WP_000332219.1.68589 WP_000332219.1.68591 WP_000332219.1.68655 WP_000332219.1.68656 WP_000332219.1.68658 WP_000332219.1.68690 WP_000332219.1.68778 WP_000332219.1.68787 WP_000332219.1.6879 WP_000332219.1.6883 WP_000332219.1.68894 WP_000332219.1.68928 WP_000332219.1.68958 WP_000332219.1.68966 WP_000332219.1.68975 WP_000332219.1.69006 WP_000332219.1.69029 WP_000332219.1.6905 WP_000332219.1.6913 WP_000332219.1.69146 WP_000332219.1.69255 WP_000332219.1.69296 WP_000332219.1.69320 WP_000332219.1.69346 WP_000332219.1.69397 WP_000332219.1.69515 WP_000332219.1.69554 WP_000332219.1.69564 WP_000332219.1.69588 WP_000332219.1.69592 WP_000332219.1.69597 WP_000332219.1.69644 WP_000332219.1.69696 WP_000332219.1.69704 WP_000332219.1.69754 WP_000332219.1.69787 WP_000332219.1.69790 WP_000332219.1.69807 WP_000332219.1.69808 WP_000332219.1.69848 WP_000332219.1.69975 WP_000332219.1.69977 WP_000332219.1.69982 WP_000332219.1.70003 WP_000332219.1.70028 WP_000332219.1.70087 WP_000332219.1.7016 WP_000332219.1.70169 WP_000332219.1.7021 WP_000332219.1.70241 WP_000332219.1.70269 WP_000332219.1.70289 WP_000332219.1.70327 WP_000332219.1.70447 WP_000332219.1.70485 WP_000332219.1.70488 WP_000332219.1.7055 WP_000332219.1.70580 WP_000332219.1.70643 WP_000332219.1.70683 WP_000332219.1.70732 WP_000332219.1.70733 WP_000332219.1.70761 WP_000332219.1.70797 WP_000332219.1.70869 WP_000332219.1.70883 WP_000332219.1.70899 WP_000332219.1.70914 WP_000332219.1.70922 WP_000332219.1.70948 WP_000332219.1.70969 WP_000332219.1.71007 WP_000332219.1.71010 WP_000332219.1.71069 WP_000332219.1.71116 WP_000332219.1.71120 WP_000332219.1.71146 WP_000332219.1.71150 WP_000332219.1.71165 WP_000332219.1.71171 WP_000332219.1.71188 WP_000332219.1.71202 WP_000332219.1.71243 WP_000332219.1.71248 WP_000332219.1.71268 WP_000332219.1.71306 WP_000332219.1.71337 WP_000332219.1.7134 WP_000332219.1.71368 WP_000332219.1.71378 WP_000332219.1.714 WP_000332219.1.71401 WP_000332219.1.71407 WP_000332219.1.71691 WP_000332219.1.71702 WP_000332219.1.71750 WP_000332219.1.71845 WP_000332219.1.71881 WP_000332219.1.71908 WP_000332219.1.71929 WP_000332219.1.71952 WP_000332219.1.71973 WP_000332219.1.72068 WP_000332219.1.72105 WP_000332219.1.72107 WP_000332219.1.72119 WP_000332219.1.72203 WP_000332219.1.72234 WP_000332219.1.72243 WP_000332219.1.72281 WP_000332219.1.72351 WP_000332219.1.72372 WP_000332219.1.72376 WP_000332219.1.72594 WP_000332219.1.72629 WP_000332219.1.72642 WP_000332219.1.72671 WP_000332219.1.72793 WP_000332219.1.72843 WP_000332219.1.72871 WP_000332219.1.72887 WP_000332219.1.72892 WP_000332219.1.72897 WP_000332219.1.72975 WP_000332219.1.73062 WP_000332219.1.7315 WP_000332219.1.73164 WP_000332219.1.73200 WP_000332219.1.7334 WP_000332219.1.73377 WP_000332219.1.73481 WP_000332219.1.73512 WP_000332219.1.7356 WP_000332219.1.73561 WP_000332219.1.73581 WP_000332219.1.73617 WP_000332219.1.73667 WP_000332219.1.73669 WP_000332219.1.73758 WP_000332219.1.73794 WP_000332219.1.7386 WP_000332219.1.7387 WP_000332219.1.73924 WP_000332219.1.73926 WP_000332219.1.7394 WP_000332219.1.73956 WP_000332219.1.74029 WP_000332219.1.74049 WP_000332219.1.74089 WP_000332219.1.74181 WP_000332219.1.74191 WP_000332219.1.74228 WP_000332219.1.7433 WP_000332219.1.74379 WP_000332219.1.74410 WP_000332219.1.74414 WP_000332219.1.74418 WP_000332219.1.74422 WP_000332219.1.74428 WP_000332219.1.7444 WP_000332219.1.74454 WP_000332219.1.74466 WP_000332219.1.74481 WP_000332219.1.74529 WP_000332219.1.74545 WP_000332219.1.74570 WP_000332219.1.7458 WP_000332219.1.74639 WP_000332219.1.74661 WP_000332219.1.74745 WP_000332219.1.74807 WP_000332219.1.74826 WP_000332219.1.75009 WP_000332219.1.75114 WP_000332219.1.75129 WP_000332219.1.75180 WP_000332219.1.75187 WP_000332219.1.75288 WP_000332219.1.75301 WP_000332219.1.7531 WP_000332219.1.75334 WP_000332219.1.75362 WP_000332219.1.75385 WP_000332219.1.75392 WP_000332219.1.75609 WP_000332219.1.75664 WP_000332219.1.75703 WP_000332219.1.75740 WP_000332219.1.75760 WP_000332219.1.75764 WP_000332219.1.75828 WP_000332219.1.75837 WP_000332219.1.75873 WP_000332219.1.75874 WP_000332219.1.75884 WP_000332219.1.75932 WP_000332219.1.75945 WP_000332219.1.75957 WP_000332219.1.76020 WP_000332219.1.76024 WP_000332219.1.76102 WP_000332219.1.76170 WP_000332219.1.76186 WP_000332219.1.76197 WP_000332219.1.76252 WP_000332219.1.7629 WP_000332219.1.7633 WP_000332219.1.76434 WP_000332219.1.76445 WP_000332219.1.76532 WP_000332219.1.76548 WP_000332219.1.7657 WP_000332219.1.76576 WP_000332219.1.7660 WP_000332219.1.76673 WP_000332219.1.76706 WP_000332219.1.7672 WP_000332219.1.76721 WP_000332219.1.76724 WP_000332219.1.76756 WP_000332219.1.76760 WP_000332219.1.76799 WP_000332219.1.7684 WP_000332219.1.76866 WP_000332219.1.76875 WP_000332219.1.76880 WP_000332219.1.76899 WP_000332219.1.77017 WP_000332219.1.77038 WP_000332219.1.77047 WP_000332219.1.77080 WP_000332219.1.7712 WP_000332219.1.77180 WP_000332219.1.77193 WP_000332219.1.77241 WP_000332219.1.77244 WP_000332219.1.77292 WP_000332219.1.77349 WP_000332219.1.77390 WP_000332219.1.77414 WP_000332219.1.77436 WP_000332219.1.77514 WP_000332219.1.77529 WP_000332219.1.77549 WP_000332219.1.77555 WP_000332219.1.77653 WP_000332219.1.77692 WP_000332219.1.77754 WP_000332219.1.77761 WP_000332219.1.7782 WP_000332219.1.77851 WP_000332219.1.77871 WP_000332219.1.77898 WP_000332219.1.77918 WP_000332219.1.77960 WP_000332219.1.77971 WP_000332219.1.78 WP_000332219.1.78016 WP_000332219.1.78026 WP_000332219.1.78033 WP_000332219.1.78053 WP_000332219.1.78076 WP_000332219.1.78096 WP_000332219.1.78100 WP_000332219.1.78110 WP_000332219.1.78120 WP_000332219.1.7814 WP_000332219.1.78168 WP_000332219.1.78301 WP_000332219.1.78383 WP_000332219.1.78407 WP_000332219.1.78495 WP_000332219.1.78496 WP_000332219.1.7861 WP_000332219.1.78618 WP_000332219.1.78673 WP_000332219.1.78715 WP_000332219.1.78735 WP_000332219.1.78738 WP_000332219.1.78789 WP_000332219.1.78802 WP_000332219.1.78830 WP_000332219.1.78835 WP_000332219.1.78862 WP_000332219.1.78871 WP_000332219.1.78874 WP_000332219.1.78881 WP_000332219.1.7891 WP_000332219.1.78913 WP_000332219.1.78918 WP_000332219.1.78930 WP_000332219.1.79151 WP_000332219.1.79167 WP_000332219.1.79189 WP_000332219.1.79203 WP_000332219.1.79335 WP_000332219.1.794 WP_000332219.1.79427 WP_000332219.1.79462 WP_000332219.1.79472 WP_000332219.1.79490 WP_000332219.1.79495 WP_000332219.1.79529 WP_000332219.1.7956 WP_000332219.1.79570 WP_000332219.1.79635 WP_000332219.1.7964 WP_000332219.1.79642 WP_000332219.1.79645 WP_000332219.1.79659 WP_000332219.1.79668 WP_000332219.1.79708 WP_000332219.1.7972 WP_000332219.1.79738 WP_000332219.1.79778 WP_000332219.1.7979 WP_000332219.1.79832 WP_000332219.1.79845 WP_000332219.1.79867 WP_000332219.1.79914 WP_000332219.1.7994 WP_000332219.1.79942 WP_000332219.1.79951 WP_000332219.1.79974 WP_000332219.1.79996 WP_000332219.1.80077 WP_000332219.1.80137 WP_000332219.1.80182 WP_000332219.1.80250 WP_000332219.1.80293 WP_000332219.1.80296 WP_000332219.1.80366 WP_000332219.1.80441 WP_000332219.1.80448 WP_000332219.1.80473 WP_000332219.1.80479 WP_000332219.1.80629 WP_000332219.1.80651 WP_000332219.1.80723 WP_000332219.1.80757 WP_000332219.1.80780 WP_000332219.1.80827 WP_000332219.1.80831 WP_000332219.1.80840 WP_000332219.1.80850 WP_000332219.1.80857 WP_000332219.1.80868 WP_000332219.1.80881 WP_000332219.1.80939 WP_000332219.1.80959 WP_000332219.1.8096 WP_000332219.1.80973 WP_000332219.1.81037 WP_000332219.1.81069 WP_000332219.1.81149 WP_000332219.1.81175 WP_000332219.1.8119 WP_000332219.1.81193 WP_000332219.1.8127 WP_000332219.1.81275 WP_000332219.1.81302 WP_000332219.1.81354 WP_000332219.1.81404 WP_000332219.1.81425 WP_000332219.1.81504 WP_000332219.1.81727 WP_000332219.1.81736 WP_000332219.1.81743 WP_000332219.1.81750 WP_000332219.1.81760 WP_000332219.1.81785 WP_000332219.1.81902 WP_000332219.1.81941 WP_000332219.1.8196 WP_000332219.1.81974 WP_000332219.1.81977 WP_000332219.1.81995 WP_000332219.1.82037 WP_000332219.1.82099 WP_000332219.1.82269 WP_000332219.1.82337 WP_000332219.1.82347 WP_000332219.1.82352 WP_000332219.1.82395 WP_000332219.1.82479 WP_000332219.1.82503 WP_000332219.1.82515 WP_000332219.1.82529 WP_000332219.1.82530 WP_000332219.1.82570 WP_000332219.1.82584 WP_000332219.1.82637 WP_000332219.1.82648 WP_000332219.1.82676 WP_000332219.1.82761 WP_000332219.1.8282 WP_000332219.1.82899 WP_000332219.1.82908 WP_000332219.1.82944 WP_000332219.1.82946 WP_000332219.1.82956 WP_000332219.1.82964 WP_000332219.1.83092 WP_000332219.1.83128 WP_000332219.1.83163 WP_000332219.1.83247 WP_000332219.1.83258 WP_000332219.1.83305 WP_000332219.1.83360 WP_000332219.1.83365 WP_000332219.1.83388 WP_000332219.1.83413 WP_000332219.1.83491 WP_000332219.1.83510 WP_000332219.1.83516 WP_000332219.1.83523 WP_000332219.1.8354 WP_000332219.1.83710 WP_000332219.1.83721 WP_000332219.1.83739 WP_000332219.1.83760 WP_000332219.1.83995 WP_000332219.1.84077 WP_000332219.1.84103 WP_000332219.1.84106 WP_000332219.1.84168 WP_000332219.1.84209 WP_000332219.1.84229 WP_000332219.1.84283 WP_000332219.1.84373 WP_000332219.1.84392 WP_000332219.1.84403 WP_000332219.1.8441 WP_000332219.1.84459 WP_000332219.1.84461 WP_000332219.1.84475 WP_000332219.1.84532 WP_000332219.1.84551 WP_000332219.1.84554 WP_000332219.1.84644 WP_000332219.1.84659 WP_000332219.1.84711 WP_000332219.1.84899 WP_000332219.1.849 WP_000332219.1.8497 WP_000332219.1.850 WP_000332219.1.85031 WP_000332219.1.85040 WP_000332219.1.85134 WP_000332219.1.85178 WP_000332219.1.85190 WP_000332219.1.85192 WP_000332219.1.85217 WP_000332219.1.8533 WP_000332219.1.8537 WP_000332219.1.85408 WP_000332219.1.85456 WP_000332219.1.85481 WP_000332219.1.85483 WP_000332219.1.85541 WP_000332219.1.8556 WP_000332219.1.85615 WP_000332219.1.85617 WP_000332219.1.85663 WP_000332219.1.85671 WP_000332219.1.85672 WP_000332219.1.85675 WP_000332219.1.85723 WP_000332219.1.85742 WP_000332219.1.85777 WP_000332219.1.85780 WP_000332219.1.85784 WP_000332219.1.85854 WP_000332219.1.85855 WP_000332219.1.85864 WP_000332219.1.85886 WP_000332219.1.85900 WP_000332219.1.85904 WP_000332219.1.8591 WP_000332219.1.85943 WP_000332219.1.85976 WP_000332219.1.86007 WP_000332219.1.86010 WP_000332219.1.86120 WP_000332219.1.86224 WP_000332219.1.86284 WP_000332219.1.86285 WP_000332219.1.86306 WP_000332219.1.86356 WP_000332219.1.86389 WP_000332219.1.86442 WP_000332219.1.86450 WP_000332219.1.86469 WP_000332219.1.86580 WP_000332219.1.86588 WP_000332219.1.86593 WP_000332219.1.86656 WP_000332219.1.86661 WP_000332219.1.86676 WP_000332219.1.8672 WP_000332219.1.8678 WP_000332219.1.86807 WP_000332219.1.86810 WP_000332219.1.8684 WP_000332219.1.86860 WP_000332219.1.86895 WP_000332219.1.86906 WP_000332219.1.8691 WP_000332219.1.86921 WP_000332219.1.87051 WP_000332219.1.87095 WP_000332219.1.87219 WP_000332219.1.8722 WP_000332219.1.87282 WP_000332219.1.87323 WP_000332219.1.8736 WP_000332219.1.87365 WP_000332219.1.87460 WP_000332219.1.87493 WP_000332219.1.87552 WP_000332219.1.87626 WP_000332219.1.87779 WP_000332219.1.87933 WP_000332219.1.87945 WP_000332219.1.87999 WP_000332219.1.8800 WP_000332219.1.88014 WP_000332219.1.88019 WP_000332219.1.88073 WP_000332219.1.8809 WP_000332219.1.88165 WP_000332219.1.88174 WP_000332219.1.88214 WP_000332219.1.88222 WP_000332219.1.88264 WP_000332219.1.88291 WP_000332219.1.88293 WP_000332219.1.8837 WP_000332219.1.88393 WP_000332219.1.88423 WP_000332219.1.8849 WP_000332219.1.88609 WP_000332219.1.88624 WP_000332219.1.88651 WP_000332219.1.88683 WP_000332219.1.88698 WP_000332219.1.88703 WP_000332219.1.88762 WP_000332219.1.88776 WP_000332219.1.88792 WP_000332219.1.88845 WP_000332219.1.88902 WP_000332219.1.8891 WP_000332219.1.88967 WP_000332219.1.88970 WP_000332219.1.88981 WP_000332219.1.88995 WP_000332219.1.89008 WP_000332219.1.89054 WP_000332219.1.89116 WP_000332219.1.89138 WP_000332219.1.89188 WP_000332219.1.89215 WP_000332219.1.89304 WP_000332219.1.89311 WP_000332219.1.89462 WP_000332219.1.89512 WP_000332219.1.89527 WP_000332219.1.89570 WP_000332219.1.89580 WP_000332219.1.89604 WP_000332219.1.89622 WP_000332219.1.89632 WP_000332219.1.89659 WP_000332219.1.89789 WP_000332219.1.89815 WP_000332219.1.89870 WP_000332219.1.89902 WP_000332219.1.89940 WP_000332219.1.8996 WP_000332219.1.9002 WP_000332219.1.90033 WP_000332219.1.90097 WP_000332219.1.90193 WP_000332219.1.90211 WP_000332219.1.90220 WP_000332219.1.90252 WP_000332219.1.90348 WP_000332219.1.90417 WP_000332219.1.90440 WP_000332219.1.90453 WP_000332219.1.90458 WP_000332219.1.90521 WP_000332219.1.90557 WP_000332219.1.90585 WP_000332219.1.90620 WP_000332219.1.9064 WP_000332219.1.90641 WP_000332219.1.90686 WP_000332219.1.90734 WP_000332219.1.90814 WP_000332219.1.9093 WP_000332219.1.91003 WP_000332219.1.91023 WP_000332219.1.91042 WP_000332219.1.91069 WP_000332219.1.91107 WP_000332219.1.91156 WP_000332219.1.91189 WP_000332219.1.91278 WP_000332219.1.91381 WP_000332219.1.91459 WP_000332219.1.91473 WP_000332219.1.91493 WP_000332219.1.91512 WP_000332219.1.91564 WP_000332219.1.91580 WP_000332219.1.91625 WP_000332219.1.91628 WP_000332219.1.91655 WP_000332219.1.91724 WP_000332219.1.91732 WP_000332219.1.91788 WP_000332219.1.91864 WP_000332219.1.92013 WP_000332219.1.92044 WP_000332219.1.92060 WP_000332219.1.92067 WP_000332219.1.92099 WP_000332219.1.92108 WP_000332219.1.92122 WP_000332219.1.92149 WP_000332219.1.92171 WP_000332219.1.92183 WP_000332219.1.92208 WP_000332219.1.92213 WP_000332219.1.92268 WP_000332219.1.92310 WP_000332219.1.92318 WP_000332219.1.92394 WP_000332219.1.92399 WP_000332219.1.92408 WP_000332219.1.92411 WP_000332219.1.92443 WP_000332219.1.92482 WP_000332219.1.92529 WP_000332219.1.92531 WP_000332219.1.92562 WP_000332219.1.92575 WP_000332219.1.92659 WP_000332219.1.92669 WP_000332219.1.92671 WP_000332219.1.92738 WP_000332219.1.92758 WP_000332219.1.92827 WP_000332219.1.92832 WP_000332219.1.92875 WP_000332219.1.92879 WP_000332219.1.92895 WP_000332219.1.93086 WP_000332219.1.93101 WP_000332219.1.93136 WP_000332219.1.93155 WP_000332219.1.93213 WP_000332219.1.93275 WP_000332219.1.93322 WP_000332219.1.93365 WP_000332219.1.93376 WP_000332219.1.93543 WP_000332219.1.93648 WP_000332219.1.93650 WP_000332219.1.93656 WP_000332219.1.93662 WP_000332219.1.93671 WP_000332219.1.93691 WP_000332219.1.937 WP_000332219.1.93705 WP_000332219.1.93741 WP_000332219.1.93803 WP_000332219.1.93804 WP_000332219.1.9389 WP_000332219.1.93986 WP_000332219.1.93994 WP_000332219.1.94039 WP_000332219.1.94072 WP_000332219.1.94162 WP_000332219.1.94167 WP_000332219.1.94168 WP_000332219.1.94181 WP_000332219.1.94198 WP_000332219.1.9432 WP_000332219.1.94352 WP_000332219.1.94354 WP_000332219.1.94379 WP_000332219.1.94380 WP_000332219.1.94458 WP_000332219.1.94562 WP_000332219.1.94565 WP_000332219.1.94584 WP_000332219.1.94622 WP_000332219.1.9463 WP_000332219.1.94669 WP_000332219.1.94674 WP_000332219.1.94717 WP_000332219.1.94722 WP_000332219.1.94785 WP_000332219.1.94796 WP_000332219.1.9481 WP_000332219.1.94849 WP_000332219.1.94862 WP_000332219.1.94959 WP_000332219.1.94967 WP_000332219.1.94971 WP_000332219.1.94982 WP_000332219.1.94986 WP_000332219.1.94987 WP_000332219.1.9503 WP_000332219.1.95051 WP_000332219.1.95085 WP_000332219.1.95121 WP_000332219.1.95152 WP_000332219.1.95249 WP_000332219.1.95282 WP_000332219.1.95289 WP_000332219.1.95320 WP_000332219.1.95404 WP_000332219.1.95465 WP_000332219.1.95546 WP_000332219.1.95579 WP_000332219.1.95623 WP_000332219.1.95630 WP_000332219.1.95701 WP_000332219.1.95703 WP_000332219.1.95729 WP_000332219.1.95826 WP_000332219.1.95911 WP_000332219.1.96042 WP_000332219.1.96045 WP_000332219.1.96139 WP_000332219.1.96172 WP_000332219.1.96190 WP_000332219.1.96260 WP_000332219.1.96317 WP_000332219.1.96343 WP_000332219.1.96429 WP_000332219.1.9644 WP_000332219.1.96469 WP_000332219.1.96497 WP_000332219.1.96500 WP_000332219.1.96533 WP_000332219.1.96555 WP_000332219.1.96563 WP_000332219.1.96600 WP_000332219.1.96642 WP_000332219.1.96662 WP_000332219.1.96732 WP_000332219.1.96758 WP_000332219.1.96761 WP_000332219.1.96771 WP_000332219.1.96890 WP_000332219.1.96902 WP_000332219.1.97005 WP_000332219.1.97015 WP_000332219.1.97089 WP_000332219.1.97145 WP_000332219.1.97190 WP_000332219.1.97224 WP_000332219.1.97318 WP_000332219.1.97369 WP_000332219.1.97386 WP_000332219.1.97413 WP_000332219.1.97480 WP_000332219.1.97496 WP_000332219.1.97594 WP_000332219.1.97597 WP_000332219.1.97613 WP_000332219.1.97620 WP_000332219.1.97626 WP_000332219.1.97640 WP_000332219.1.97691 WP_000332219.1.97726 WP_000332219.1.97727 WP_000332219.1.97732 WP_000332219.1.97736 WP_000332219.1.9775 WP_000332219.1.97846 WP_000332219.1.97873 WP_000332219.1.97983 WP_000332219.1.98006 WP_000332219.1.98019 WP_000332219.1.98022 WP_000332219.1.9805 WP_000332219.1.98107 WP_000332219.1.9811 WP_000332219.1.98110 WP_000332219.1.98124 WP_000332219.1.98219 WP_000332219.1.98250 WP_000332219.1.98314 WP_000332219.1.98392 WP_000332219.1.9841 WP_000332219.1.98438 WP_000332219.1.98446 WP_000332219.1.98483 WP_000332219.1.98495 WP_000332219.1.98531 WP_000332219.1.98577 WP_000332219.1.9863 WP_000332219.1.98676 WP_000332219.1.98677 WP_000332219.1.98751 WP_000332219.1.98760 WP_000332219.1.98763 WP_000332219.1.98779 WP_000332219.1.98843 WP_000332219.1.98931 WP_000332219.1.9898 WP_000332219.1.99107 WP_000332219.1.99184 WP_000332219.1.99197 WP_000332219.1.99267 WP_000332219.1.99276 WP_000332219.1.99278 WP_000332219.1.99339 WP_000332219.1.99370 WP_000332219.1.99561 WP_000332219.1.99637 WP_000332219.1.99646 WP_000332219.1.99657 WP_000332219.1.99660 WP_000332219.1.99712 WP_000332219.1.99747 WP_000332219.1.99783 WP_000332219.1.99813 WP_000332219.1.99858 WP_000332219.1.99889 WP_000332219.1.99958 gi|549481538|ref|YP_008616016.1| gi|16767669|ref|NP_463284.1| gi|378991688|ref|YP_005254852.1| gi|378453385|ref|YP_005240745.1| gi|563655711|ref|YP_008863815.1| ABFF01000010|CDS_153656-152832 AE006468|CDS_4665886-4666710 CP001138|CDS_4598217-4599041 CP001363|CDS_4678716-4679540 FN424405|CDS_4687873-4688697 gi|378702261|ref|YP_005184219.1| gi|525856306|ref|YP_008259055.1| gi|197251833|ref|YP_002149339.1| gi|379703661|ref|YP_005245389.1| gi|378447734|ref|YP_005235366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]