SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378453481|ref|YP_005240841.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378453481|ref|YP_005240841.1|
Domain Number 1 Region: 30-159
Classification Level Classification E-value
Superfamily Hcp1-like 3.27e-32
Family Hcp1-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378453481|ref|YP_005240841.1|
Sequence length 176
Comment putative hyperinvasive locus E [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MAGKWNVLSLLAFRPCQPALPHDNHGGGMDAIYLKLDGIEGESRIKGFENQIKLIAYNHN
PTKRESGEARGTYIGGLTLTKPVDLATPGLYEHYCNGKTVKEGVLTLCRRDKGAMLPFII
YTLTNVRISRMSNHGDAEGSATETVDLVYSHIRWDIPALASKSKTRRPLHRQALWR
Download sequence
Identical sequences A0A0F6BB42 A0A1X2RSP3 A0A1X2V8G6 A0A1X2YA60 A0A1Z3QBK3 A0A221X8E5 A0A221Z4P9 A0A265BBG1 A0A267S776 A0A271CI42 A0A2C9P3Y8 A0A2D1XWH0 A0A2D1Y9Z2 A0A2G1PCK5 A0A2H9YJT8 A0A2I6MD01 A0A2I6MQK9 A0A2I6N4E1 A0A2I6NHV9 A0A2I6NVQ8 A0A2I6P8I3 A0A2J5WHH9 G4CAB6 H9L424 Q93C89 S4ID33 V7IV15
gi|378991771|ref|YP_005254935.1| gi|448967639|ref|YP_002048530.2| gi|550903841|ref|YP_008672933.1| gi|449306342|ref|YP_002117428.2| AE006468|CDS_4763557-4764087 CP001363|CDS_4776390-4776920 FN424405|CDS_4785547-4786077 gi|448967564|ref|YP_002043751.2| gi|378447816|ref|YP_005235448.1| APC24220 gi|563655821|ref|YP_008863929.1| gi|378453481|ref|YP_005240841.1| NP_463368.3.58477 WP_000907671.1.100002 WP_000907671.1.100007 WP_000907671.1.100010 WP_000907671.1.100031 WP_000907671.1.100077 WP_000907671.1.100115 WP_000907671.1.100129 WP_000907671.1.10013 WP_000907671.1.100137 WP_000907671.1.100149 WP_000907671.1.100165 WP_000907671.1.100191 WP_000907671.1.1002 WP_000907671.1.100234 WP_000907671.1.100288 WP_000907671.1.100376 WP_000907671.1.100392 WP_000907671.1.100412 WP_000907671.1.100413 WP_000907671.1.100424 WP_000907671.1.100432 WP_000907671.1.100436 WP_000907671.1.100438 WP_000907671.1.100457 WP_000907671.1.100472 WP_000907671.1.100484 WP_000907671.1.100488 WP_000907671.1.100502 WP_000907671.1.100519 WP_000907671.1.100521 WP_000907671.1.100541 WP_000907671.1.100557 WP_000907671.1.100584 WP_000907671.1.100589 WP_000907671.1.100597 WP_000907671.1.100605 WP_000907671.1.100642 WP_000907671.1.100650 WP_000907671.1.100707 WP_000907671.1.100711 WP_000907671.1.100714 WP_000907671.1.100721 WP_000907671.1.100730 WP_000907671.1.100750 WP_000907671.1.10076 WP_000907671.1.100773 WP_000907671.1.100776 WP_000907671.1.100781 WP_000907671.1.100790 WP_000907671.1.100793 WP_000907671.1.10081 WP_000907671.1.100814 WP_000907671.1.100857 WP_000907671.1.100865 WP_000907671.1.100869 WP_000907671.1.100870 WP_000907671.1.100871 WP_000907671.1.100882 WP_000907671.1.100886 WP_000907671.1.100895 WP_000907671.1.100932 WP_000907671.1.100948 WP_000907671.1.101007 WP_000907671.1.101020 WP_000907671.1.101042 WP_000907671.1.101074 WP_000907671.1.101078 WP_000907671.1.101094 WP_000907671.1.101112 WP_000907671.1.101147 WP_000907671.1.101180 WP_000907671.1.101185 WP_000907671.1.101199 WP_000907671.1.101259 WP_000907671.1.101284 WP_000907671.1.101291 WP_000907671.1.1013 WP_000907671.1.101353 WP_000907671.1.101386 WP_000907671.1.101404 WP_000907671.1.101420 WP_000907671.1.101425 WP_000907671.1.101473 WP_000907671.1.101520 WP_000907671.1.101541 WP_000907671.1.101589 WP_000907671.1.101612 WP_000907671.1.101634 WP_000907671.1.101639 WP_000907671.1.10164 WP_000907671.1.101666 WP_000907671.1.101674 WP_000907671.1.101707 WP_000907671.1.101724 WP_000907671.1.101734 WP_000907671.1.101741 WP_000907671.1.101744 WP_000907671.1.101759 WP_000907671.1.10177 WP_000907671.1.101776 WP_000907671.1.101815 WP_000907671.1.101832 WP_000907671.1.101841 WP_000907671.1.101868 WP_000907671.1.101878 WP_000907671.1.101917 WP_000907671.1.101953 WP_000907671.1.102009 WP_000907671.1.102103 WP_000907671.1.102111 WP_000907671.1.10220 WP_000907671.1.10231 WP_000907671.1.10266 WP_000907671.1.10276 WP_000907671.1.10293 WP_000907671.1.10300 WP_000907671.1.10310 WP_000907671.1.10394 WP_000907671.1.10429 WP_000907671.1.10439 WP_000907671.1.10463 WP_000907671.1.10465 WP_000907671.1.10498 WP_000907671.1.10507 WP_000907671.1.10562 WP_000907671.1.10566 WP_000907671.1.10568 WP_000907671.1.106 WP_000907671.1.10631 WP_000907671.1.10678 WP_000907671.1.10720 WP_000907671.1.10753 WP_000907671.1.10755 WP_000907671.1.10797 WP_000907671.1.10868 WP_000907671.1.10898 WP_000907671.1.10992 WP_000907671.1.11024 WP_000907671.1.11031 WP_000907671.1.11041 WP_000907671.1.11098 WP_000907671.1.1110 WP_000907671.1.11119 WP_000907671.1.11156 WP_000907671.1.11168 WP_000907671.1.11190 WP_000907671.1.11213 WP_000907671.1.11216 WP_000907671.1.11254 WP_000907671.1.11295 WP_000907671.1.113 WP_000907671.1.11304 WP_000907671.1.11362 WP_000907671.1.11369 WP_000907671.1.1137 WP_000907671.1.11405 WP_000907671.1.11444 WP_000907671.1.11455 WP_000907671.1.11458 WP_000907671.1.11479 WP_000907671.1.1150 WP_000907671.1.11511 WP_000907671.1.11518 WP_000907671.1.11526 WP_000907671.1.11528 WP_000907671.1.11532 WP_000907671.1.11543 WP_000907671.1.11544 WP_000907671.1.1156 WP_000907671.1.11565 WP_000907671.1.11588 WP_000907671.1.11603 WP_000907671.1.11621 WP_000907671.1.11677 WP_000907671.1.11681 WP_000907671.1.11687 WP_000907671.1.1169 WP_000907671.1.11735 WP_000907671.1.1174 WP_000907671.1.11763 WP_000907671.1.11772 WP_000907671.1.11824 WP_000907671.1.11834 WP_000907671.1.11841 WP_000907671.1.11865 WP_000907671.1.11868 WP_000907671.1.11875 WP_000907671.1.11897 WP_000907671.1.11900 WP_000907671.1.11936 WP_000907671.1.11938 WP_000907671.1.11978 WP_000907671.1.12007 WP_000907671.1.12017 WP_000907671.1.12027 WP_000907671.1.12047 WP_000907671.1.12059 WP_000907671.1.12063 WP_000907671.1.12106 WP_000907671.1.12114 WP_000907671.1.12144 WP_000907671.1.1215 WP_000907671.1.12160 WP_000907671.1.12168 WP_000907671.1.12244 WP_000907671.1.12280 WP_000907671.1.12282 WP_000907671.1.12340 WP_000907671.1.12351 WP_000907671.1.12370 WP_000907671.1.12374 WP_000907671.1.12396 WP_000907671.1.12397 WP_000907671.1.12456 WP_000907671.1.1246 WP_000907671.1.12484 WP_000907671.1.12485 WP_000907671.1.12546 WP_000907671.1.12568 WP_000907671.1.12569 WP_000907671.1.12584 WP_000907671.1.12585 WP_000907671.1.1264 WP_000907671.1.12650 WP_000907671.1.12696 WP_000907671.1.12718 WP_000907671.1.12728 WP_000907671.1.12864 WP_000907671.1.12877 WP_000907671.1.12879 WP_000907671.1.12936 WP_000907671.1.1299 WP_000907671.1.12995 WP_000907671.1.1300 WP_000907671.1.13027 WP_000907671.1.13076 WP_000907671.1.13101 WP_000907671.1.13102 WP_000907671.1.13106 WP_000907671.1.13130 WP_000907671.1.13207 WP_000907671.1.13247 WP_000907671.1.1326 WP_000907671.1.13274 WP_000907671.1.13311 WP_000907671.1.13367 WP_000907671.1.13391 WP_000907671.1.13414 WP_000907671.1.13446 WP_000907671.1.1346 WP_000907671.1.13488 WP_000907671.1.13509 WP_000907671.1.13528 WP_000907671.1.13543 WP_000907671.1.13573 WP_000907671.1.13625 WP_000907671.1.13661 WP_000907671.1.13669 WP_000907671.1.13677 WP_000907671.1.13691 WP_000907671.1.13741 WP_000907671.1.13799 WP_000907671.1.13819 WP_000907671.1.13827 WP_000907671.1.13829 WP_000907671.1.13848 WP_000907671.1.1387 WP_000907671.1.13908 WP_000907671.1.13932 WP_000907671.1.13968 WP_000907671.1.14001 WP_000907671.1.14111 WP_000907671.1.1412 WP_000907671.1.14151 WP_000907671.1.14212 WP_000907671.1.14239 WP_000907671.1.14286 WP_000907671.1.14296 WP_000907671.1.14320 WP_000907671.1.14379 WP_000907671.1.1440 WP_000907671.1.14406 WP_000907671.1.14410 WP_000907671.1.14436 WP_000907671.1.14446 WP_000907671.1.14458 WP_000907671.1.14466 WP_000907671.1.14505 WP_000907671.1.14516 WP_000907671.1.14519 WP_000907671.1.14524 WP_000907671.1.14528 WP_000907671.1.14554 WP_000907671.1.146 WP_000907671.1.14618 WP_000907671.1.14688 WP_000907671.1.14706 WP_000907671.1.14708 WP_000907671.1.14725 WP_000907671.1.14737 WP_000907671.1.14789 WP_000907671.1.14808 WP_000907671.1.14819 WP_000907671.1.14852 WP_000907671.1.14884 WP_000907671.1.1489 WP_000907671.1.14913 WP_000907671.1.14927 WP_000907671.1.14932 WP_000907671.1.14936 WP_000907671.1.15046 WP_000907671.1.15054 WP_000907671.1.15055 WP_000907671.1.15067 WP_000907671.1.15079 WP_000907671.1.15100 WP_000907671.1.15102 WP_000907671.1.15124 WP_000907671.1.15223 WP_000907671.1.15226 WP_000907671.1.15276 WP_000907671.1.15316 WP_000907671.1.15318 WP_000907671.1.15369 WP_000907671.1.1540 WP_000907671.1.15479 WP_000907671.1.15483 WP_000907671.1.15508 WP_000907671.1.1551 WP_000907671.1.15585 WP_000907671.1.15586 WP_000907671.1.15612 WP_000907671.1.15616 WP_000907671.1.15625 WP_000907671.1.15644 WP_000907671.1.1568 WP_000907671.1.15708 WP_000907671.1.15775 WP_000907671.1.15777 WP_000907671.1.15784 WP_000907671.1.15795 WP_000907671.1.15830 WP_000907671.1.15835 WP_000907671.1.15862 WP_000907671.1.15881 WP_000907671.1.15909 WP_000907671.1.15910 WP_000907671.1.1592 WP_000907671.1.15922 WP_000907671.1.15978 WP_000907671.1.15986 WP_000907671.1.15995 WP_000907671.1.16004 WP_000907671.1.16006 WP_000907671.1.1601 WP_000907671.1.16028 WP_000907671.1.16032 WP_000907671.1.16047 WP_000907671.1.16052 WP_000907671.1.16062 WP_000907671.1.16063 WP_000907671.1.16103 WP_000907671.1.1611 WP_000907671.1.16125 WP_000907671.1.16158 WP_000907671.1.16166 WP_000907671.1.16172 WP_000907671.1.16201 WP_000907671.1.16226 WP_000907671.1.16233 WP_000907671.1.16244 WP_000907671.1.16273 WP_000907671.1.16284 WP_000907671.1.16328 WP_000907671.1.16331 WP_000907671.1.1635 WP_000907671.1.16361 WP_000907671.1.16363 WP_000907671.1.16365 WP_000907671.1.16366 WP_000907671.1.16394 WP_000907671.1.16468 WP_000907671.1.16474 WP_000907671.1.16525 WP_000907671.1.16565 WP_000907671.1.16581 WP_000907671.1.16614 WP_000907671.1.16650 WP_000907671.1.16656 WP_000907671.1.1668 WP_000907671.1.16686 WP_000907671.1.16691 WP_000907671.1.16729 WP_000907671.1.16732 WP_000907671.1.16735 WP_000907671.1.16736 WP_000907671.1.16786 WP_000907671.1.16804 WP_000907671.1.16817 WP_000907671.1.16819 WP_000907671.1.16826 WP_000907671.1.16855 WP_000907671.1.16858 WP_000907671.1.16873 WP_000907671.1.1689 WP_000907671.1.16896 WP_000907671.1.16903 WP_000907671.1.16916 WP_000907671.1.16941 WP_000907671.1.16944 WP_000907671.1.16949 WP_000907671.1.16965 WP_000907671.1.16972 WP_000907671.1.16998 WP_000907671.1.1700 WP_000907671.1.17031 WP_000907671.1.17060 WP_000907671.1.17093 WP_000907671.1.17105 WP_000907671.1.17188 WP_000907671.1.17270 WP_000907671.1.17285 WP_000907671.1.17307 WP_000907671.1.1733 WP_000907671.1.1737 WP_000907671.1.17390 WP_000907671.1.174 WP_000907671.1.17439 WP_000907671.1.17447 WP_000907671.1.17480 WP_000907671.1.17482 WP_000907671.1.17504 WP_000907671.1.17525 WP_000907671.1.17546 WP_000907671.1.17560 WP_000907671.1.17583 WP_000907671.1.17629 WP_000907671.1.17693 WP_000907671.1.17702 WP_000907671.1.17703 WP_000907671.1.17705 WP_000907671.1.17743 WP_000907671.1.17755 WP_000907671.1.17865 WP_000907671.1.17886 WP_000907671.1.17891 WP_000907671.1.17901 WP_000907671.1.17914 WP_000907671.1.17919 WP_000907671.1.17936 WP_000907671.1.17949 WP_000907671.1.1798 WP_000907671.1.17991 WP_000907671.1.18019 WP_000907671.1.18056 WP_000907671.1.18061 WP_000907671.1.1807 WP_000907671.1.18092 WP_000907671.1.18103 WP_000907671.1.18109 WP_000907671.1.18111 WP_000907671.1.18122 WP_000907671.1.1814 WP_000907671.1.18149 WP_000907671.1.18163 WP_000907671.1.18177 WP_000907671.1.18178 WP_000907671.1.1818 WP_000907671.1.18192 WP_000907671.1.18249 WP_000907671.1.18254 WP_000907671.1.18265 WP_000907671.1.18267 WP_000907671.1.18277 WP_000907671.1.18281 WP_000907671.1.18282 WP_000907671.1.18365 WP_000907671.1.18384 WP_000907671.1.18426 WP_000907671.1.18441 WP_000907671.1.18445 WP_000907671.1.18468 WP_000907671.1.18485 WP_000907671.1.18489 WP_000907671.1.18607 WP_000907671.1.18641 WP_000907671.1.18692 WP_000907671.1.18705 WP_000907671.1.18715 WP_000907671.1.18737 WP_000907671.1.18776 WP_000907671.1.18822 WP_000907671.1.18847 WP_000907671.1.18881 WP_000907671.1.18886 WP_000907671.1.18895 WP_000907671.1.18919 WP_000907671.1.18940 WP_000907671.1.18949 WP_000907671.1.1895 WP_000907671.1.1897 WP_000907671.1.19030 WP_000907671.1.19038 WP_000907671.1.19053 WP_000907671.1.19055 WP_000907671.1.19064 WP_000907671.1.19093 WP_000907671.1.19163 WP_000907671.1.19174 WP_000907671.1.19240 WP_000907671.1.19273 WP_000907671.1.19320 WP_000907671.1.19340 WP_000907671.1.19357 WP_000907671.1.19373 WP_000907671.1.1939 WP_000907671.1.19405 WP_000907671.1.19433 WP_000907671.1.19458 WP_000907671.1.19460 WP_000907671.1.19461 WP_000907671.1.19469 WP_000907671.1.1954 WP_000907671.1.1955 WP_000907671.1.19588 WP_000907671.1.19614 WP_000907671.1.19616 WP_000907671.1.19642 WP_000907671.1.19656 WP_000907671.1.19660 WP_000907671.1.19683 WP_000907671.1.19702 WP_000907671.1.19706 WP_000907671.1.19723 WP_000907671.1.19724 WP_000907671.1.19749 WP_000907671.1.19784 WP_000907671.1.19793 WP_000907671.1.19802 WP_000907671.1.19809 WP_000907671.1.19823 WP_000907671.1.19834 WP_000907671.1.19851 WP_000907671.1.19863 WP_000907671.1.19867 WP_000907671.1.19884 WP_000907671.1.1990 WP_000907671.1.19938 WP_000907671.1.19970 WP_000907671.1.19975 WP_000907671.1.1998 WP_000907671.1.19987 WP_000907671.1.20 WP_000907671.1.20023 WP_000907671.1.20034 WP_000907671.1.20081 WP_000907671.1.20086 WP_000907671.1.20089 WP_000907671.1.20091 WP_000907671.1.2010 WP_000907671.1.20119 WP_000907671.1.20212 WP_000907671.1.20218 WP_000907671.1.2026 WP_000907671.1.20261 WP_000907671.1.20266 WP_000907671.1.20271 WP_000907671.1.20349 WP_000907671.1.2036 WP_000907671.1.20362 WP_000907671.1.20364 WP_000907671.1.20376 WP_000907671.1.20391 WP_000907671.1.2041 WP_000907671.1.20418 WP_000907671.1.20425 WP_000907671.1.20437 WP_000907671.1.20443 WP_000907671.1.20446 WP_000907671.1.2047 WP_000907671.1.20525 WP_000907671.1.2054 WP_000907671.1.20553 WP_000907671.1.20573 WP_000907671.1.20614 WP_000907671.1.20626 WP_000907671.1.20631 WP_000907671.1.20646 WP_000907671.1.20695 WP_000907671.1.20700 WP_000907671.1.20721 WP_000907671.1.20760 WP_000907671.1.20787 WP_000907671.1.20789 WP_000907671.1.20795 WP_000907671.1.20810 WP_000907671.1.20839 WP_000907671.1.20886 WP_000907671.1.20908 WP_000907671.1.2091 WP_000907671.1.2101 WP_000907671.1.21049 WP_000907671.1.21075 WP_000907671.1.21079 WP_000907671.1.21086 WP_000907671.1.21089 WP_000907671.1.21103 WP_000907671.1.21136 WP_000907671.1.21146 WP_000907671.1.2116 WP_000907671.1.21165 WP_000907671.1.21181 WP_000907671.1.21194 WP_000907671.1.21202 WP_000907671.1.21241 WP_000907671.1.21245 WP_000907671.1.21246 WP_000907671.1.21260 WP_000907671.1.21269 WP_000907671.1.2130 WP_000907671.1.21309 WP_000907671.1.21326 WP_000907671.1.21332 WP_000907671.1.21351 WP_000907671.1.21362 WP_000907671.1.21400 WP_000907671.1.21423 WP_000907671.1.21453 WP_000907671.1.21473 WP_000907671.1.21497 WP_000907671.1.21499 WP_000907671.1.21603 WP_000907671.1.21681 WP_000907671.1.21692 WP_000907671.1.21715 WP_000907671.1.21728 WP_000907671.1.21730 WP_000907671.1.21750 WP_000907671.1.21751 WP_000907671.1.21757 WP_000907671.1.21792 WP_000907671.1.21825 WP_000907671.1.21845 WP_000907671.1.21877 WP_000907671.1.21909 WP_000907671.1.21940 WP_000907671.1.21950 WP_000907671.1.21981 WP_000907671.1.21991 WP_000907671.1.22019 WP_000907671.1.22024 WP_000907671.1.22030 WP_000907671.1.2205 WP_000907671.1.22051 WP_000907671.1.22062 WP_000907671.1.22067 WP_000907671.1.22069 WP_000907671.1.22096 WP_000907671.1.22117 WP_000907671.1.22136 WP_000907671.1.22158 WP_000907671.1.22162 WP_000907671.1.22169 WP_000907671.1.2221 WP_000907671.1.22235 WP_000907671.1.2224 WP_000907671.1.22296 WP_000907671.1.22315 WP_000907671.1.22323 WP_000907671.1.22337 WP_000907671.1.22346 WP_000907671.1.2235 WP_000907671.1.22379 WP_000907671.1.22388 WP_000907671.1.22427 WP_000907671.1.22449 WP_000907671.1.22453 WP_000907671.1.22454 WP_000907671.1.2246 WP_000907671.1.22460 WP_000907671.1.22485 WP_000907671.1.22514 WP_000907671.1.22575 WP_000907671.1.22582 WP_000907671.1.22595 WP_000907671.1.22604 WP_000907671.1.22605 WP_000907671.1.22620 WP_000907671.1.22623 WP_000907671.1.22676 WP_000907671.1.22692 WP_000907671.1.22758 WP_000907671.1.22760 WP_000907671.1.2283 WP_000907671.1.22845 WP_000907671.1.22855 WP_000907671.1.22857 WP_000907671.1.22864 WP_000907671.1.22870 WP_000907671.1.22880 WP_000907671.1.22902 WP_000907671.1.22947 WP_000907671.1.22966 WP_000907671.1.22979 WP_000907671.1.23010 WP_000907671.1.23053 WP_000907671.1.23080 WP_000907671.1.23102 WP_000907671.1.23114 WP_000907671.1.2314 WP_000907671.1.23155 WP_000907671.1.23169 WP_000907671.1.23172 WP_000907671.1.23192 WP_000907671.1.23201 WP_000907671.1.2324 WP_000907671.1.23246 WP_000907671.1.23258 WP_000907671.1.23259 WP_000907671.1.23274 WP_000907671.1.23279 WP_000907671.1.23309 WP_000907671.1.23329 WP_000907671.1.23379 WP_000907671.1.23409 WP_000907671.1.2342 WP_000907671.1.23442 WP_000907671.1.23444 WP_000907671.1.23460 WP_000907671.1.23466 WP_000907671.1.23472 WP_000907671.1.23482 WP_000907671.1.23485 WP_000907671.1.235 WP_000907671.1.23503 WP_000907671.1.23509 WP_000907671.1.23513 WP_000907671.1.23529 WP_000907671.1.2358 WP_000907671.1.23587 WP_000907671.1.23621 WP_000907671.1.23629 WP_000907671.1.23631 WP_000907671.1.23634 WP_000907671.1.23639 WP_000907671.1.2364 WP_000907671.1.23643 WP_000907671.1.23670 WP_000907671.1.23675 WP_000907671.1.23685 WP_000907671.1.23707 WP_000907671.1.23736 WP_000907671.1.23746 WP_000907671.1.23755 WP_000907671.1.2376 WP_000907671.1.23819 WP_000907671.1.23932 WP_000907671.1.23959 WP_000907671.1.24017 WP_000907671.1.24082 WP_000907671.1.24145 WP_000907671.1.2415 WP_000907671.1.24158 WP_000907671.1.24163 WP_000907671.1.24206 WP_000907671.1.24214 WP_000907671.1.24250 WP_000907671.1.24259 WP_000907671.1.24297 WP_000907671.1.24303 WP_000907671.1.24308 WP_000907671.1.24325 WP_000907671.1.24361 WP_000907671.1.24376 WP_000907671.1.24392 WP_000907671.1.24409 WP_000907671.1.24412 WP_000907671.1.24419 WP_000907671.1.24433 WP_000907671.1.24444 WP_000907671.1.24450 WP_000907671.1.24494 WP_000907671.1.24521 WP_000907671.1.24555 WP_000907671.1.24567 WP_000907671.1.24578 WP_000907671.1.2467 WP_000907671.1.24673 WP_000907671.1.24696 WP_000907671.1.24727 WP_000907671.1.24737 WP_000907671.1.24779 WP_000907671.1.24837 WP_000907671.1.24873 WP_000907671.1.24901 WP_000907671.1.24944 WP_000907671.1.25008 WP_000907671.1.25015 WP_000907671.1.25036 WP_000907671.1.25072 WP_000907671.1.25119 WP_000907671.1.25175 WP_000907671.1.25205 WP_000907671.1.25217 WP_000907671.1.25229 WP_000907671.1.2525 WP_000907671.1.25297 WP_000907671.1.25354 WP_000907671.1.25397 WP_000907671.1.25405 WP_000907671.1.25426 WP_000907671.1.25454 WP_000907671.1.25493 WP_000907671.1.25498 WP_000907671.1.25514 WP_000907671.1.2554 WP_000907671.1.25546 WP_000907671.1.25564 WP_000907671.1.25596 WP_000907671.1.25618 WP_000907671.1.25668 WP_000907671.1.25690 WP_000907671.1.2570 WP_000907671.1.25700 WP_000907671.1.25703 WP_000907671.1.25708 WP_000907671.1.25722 WP_000907671.1.25740 WP_000907671.1.25780 WP_000907671.1.25793 WP_000907671.1.25809 WP_000907671.1.2581 WP_000907671.1.25814 WP_000907671.1.25825 WP_000907671.1.25932 WP_000907671.1.25951 WP_000907671.1.25988 WP_000907671.1.26030 WP_000907671.1.26034 WP_000907671.1.26075 WP_000907671.1.26083 WP_000907671.1.26093 WP_000907671.1.26123 WP_000907671.1.26129 WP_000907671.1.26194 WP_000907671.1.26213 WP_000907671.1.26224 WP_000907671.1.26269 WP_000907671.1.26282 WP_000907671.1.26311 WP_000907671.1.26319 WP_000907671.1.2634 WP_000907671.1.26363 WP_000907671.1.26426 WP_000907671.1.26429 WP_000907671.1.26440 WP_000907671.1.26441 WP_000907671.1.26493 WP_000907671.1.26512 WP_000907671.1.26563 WP_000907671.1.26567 WP_000907671.1.26576 WP_000907671.1.26582 WP_000907671.1.2660 WP_000907671.1.26646 WP_000907671.1.2667 WP_000907671.1.26687 WP_000907671.1.26709 WP_000907671.1.2672 WP_000907671.1.26741 WP_000907671.1.26787 WP_000907671.1.26794 WP_000907671.1.26833 WP_000907671.1.26856 WP_000907671.1.26883 WP_000907671.1.26919 WP_000907671.1.26924 WP_000907671.1.26936 WP_000907671.1.26980 WP_000907671.1.27010 WP_000907671.1.27051 WP_000907671.1.27055 WP_000907671.1.27084 WP_000907671.1.27122 WP_000907671.1.27169 WP_000907671.1.27173 WP_000907671.1.272 WP_000907671.1.27206 WP_000907671.1.27223 WP_000907671.1.2723 WP_000907671.1.27255 WP_000907671.1.27272 WP_000907671.1.27279 WP_000907671.1.27314 WP_000907671.1.27342 WP_000907671.1.27383 WP_000907671.1.27419 WP_000907671.1.27423 WP_000907671.1.27513 WP_000907671.1.27523 WP_000907671.1.27544 WP_000907671.1.27547 WP_000907671.1.27556 WP_000907671.1.27561 WP_000907671.1.27616 WP_000907671.1.2763 WP_000907671.1.27632 WP_000907671.1.27638 WP_000907671.1.27655 WP_000907671.1.27658 WP_000907671.1.27665 WP_000907671.1.27679 WP_000907671.1.27707 WP_000907671.1.27713 WP_000907671.1.27755 WP_000907671.1.27761 WP_000907671.1.2777 WP_000907671.1.27776 WP_000907671.1.27798 WP_000907671.1.27800 WP_000907671.1.27815 WP_000907671.1.27833 WP_000907671.1.27857 WP_000907671.1.27883 WP_000907671.1.27969 WP_000907671.1.27977 WP_000907671.1.27995 WP_000907671.1.27997 WP_000907671.1.28002 WP_000907671.1.28032 WP_000907671.1.28037 WP_000907671.1.28056 WP_000907671.1.2806 WP_000907671.1.28094 WP_000907671.1.28116 WP_000907671.1.28139 WP_000907671.1.28170 WP_000907671.1.28174 WP_000907671.1.28200 WP_000907671.1.28225 WP_000907671.1.28232 WP_000907671.1.28233 WP_000907671.1.28235 WP_000907671.1.2825 WP_000907671.1.28267 WP_000907671.1.28301 WP_000907671.1.28302 WP_000907671.1.28303 WP_000907671.1.2835 WP_000907671.1.28370 WP_000907671.1.28393 WP_000907671.1.28462 WP_000907671.1.28504 WP_000907671.1.2853 WP_000907671.1.28538 WP_000907671.1.28570 WP_000907671.1.28575 WP_000907671.1.28612 WP_000907671.1.28620 WP_000907671.1.28625 WP_000907671.1.28655 WP_000907671.1.28694 WP_000907671.1.287 WP_000907671.1.28733 WP_000907671.1.28773 WP_000907671.1.28775 WP_000907671.1.28776 WP_000907671.1.2879 WP_000907671.1.28811 WP_000907671.1.28830 WP_000907671.1.2890 WP_000907671.1.28902 WP_000907671.1.28921 WP_000907671.1.28938 WP_000907671.1.28946 WP_000907671.1.28963 WP_000907671.1.28977 WP_000907671.1.29006 WP_000907671.1.29010 WP_000907671.1.29099 WP_000907671.1.2910 WP_000907671.1.29113 WP_000907671.1.29168 WP_000907671.1.29190 WP_000907671.1.29218 WP_000907671.1.2924 WP_000907671.1.29255 WP_000907671.1.29265 WP_000907671.1.2932 WP_000907671.1.29379 WP_000907671.1.29422 WP_000907671.1.29436 WP_000907671.1.29454 WP_000907671.1.29509 WP_000907671.1.29530 WP_000907671.1.29588 WP_000907671.1.29593 WP_000907671.1.29601 WP_000907671.1.29606 WP_000907671.1.29615 WP_000907671.1.29619 WP_000907671.1.29682 WP_000907671.1.29704 WP_000907671.1.29732 WP_000907671.1.29768 WP_000907671.1.29774 WP_000907671.1.29775 WP_000907671.1.29827 WP_000907671.1.2984 WP_000907671.1.29845 WP_000907671.1.29898 WP_000907671.1.29923 WP_000907671.1.29924 WP_000907671.1.29969 WP_000907671.1.29990 WP_000907671.1.30006 WP_000907671.1.30022 WP_000907671.1.30027 WP_000907671.1.3005 WP_000907671.1.30059 WP_000907671.1.30086 WP_000907671.1.30093 WP_000907671.1.30165 WP_000907671.1.3017 WP_000907671.1.30179 WP_000907671.1.30180 WP_000907671.1.30195 WP_000907671.1.30202 WP_000907671.1.30210 WP_000907671.1.30213 WP_000907671.1.30225 WP_000907671.1.30238 WP_000907671.1.30246 WP_000907671.1.30278 WP_000907671.1.30331 WP_000907671.1.30389 WP_000907671.1.30437 WP_000907671.1.30469 WP_000907671.1.30492 WP_000907671.1.30505 WP_000907671.1.30507 WP_000907671.1.30535 WP_000907671.1.30547 WP_000907671.1.30548 WP_000907671.1.30573 WP_000907671.1.30589 WP_000907671.1.30602 WP_000907671.1.30627 WP_000907671.1.30635 WP_000907671.1.3066 WP_000907671.1.30696 WP_000907671.1.30752 WP_000907671.1.3076 WP_000907671.1.30794 WP_000907671.1.3080 WP_000907671.1.30803 WP_000907671.1.30819 WP_000907671.1.30833 WP_000907671.1.30835 WP_000907671.1.3089 WP_000907671.1.30909 WP_000907671.1.30934 WP_000907671.1.3095 WP_000907671.1.30968 WP_000907671.1.30972 WP_000907671.1.31 WP_000907671.1.31001 WP_000907671.1.31042 WP_000907671.1.31086 WP_000907671.1.31092 WP_000907671.1.31107 WP_000907671.1.31111 WP_000907671.1.31122 WP_000907671.1.3113 WP_000907671.1.31155 WP_000907671.1.31156 WP_000907671.1.31167 WP_000907671.1.31171 WP_000907671.1.31185 WP_000907671.1.3119 WP_000907671.1.31190 WP_000907671.1.31195 WP_000907671.1.31196 WP_000907671.1.31214 WP_000907671.1.31222 WP_000907671.1.3124 WP_000907671.1.31251 WP_000907671.1.31262 WP_000907671.1.3127 WP_000907671.1.31272 WP_000907671.1.31281 WP_000907671.1.31335 WP_000907671.1.31362 WP_000907671.1.31435 WP_000907671.1.31451 WP_000907671.1.31476 WP_000907671.1.31504 WP_000907671.1.31515 WP_000907671.1.31578 WP_000907671.1.31585 WP_000907671.1.31658 WP_000907671.1.3167 WP_000907671.1.3170 WP_000907671.1.31725 WP_000907671.1.31762 WP_000907671.1.31782 WP_000907671.1.31845 WP_000907671.1.3185 WP_000907671.1.31854 WP_000907671.1.31895 WP_000907671.1.31901 WP_000907671.1.31927 WP_000907671.1.31940 WP_000907671.1.31952 WP_000907671.1.31967 WP_000907671.1.31972 WP_000907671.1.32006 WP_000907671.1.32038 WP_000907671.1.32054 WP_000907671.1.32109 WP_000907671.1.32192 WP_000907671.1.32204 WP_000907671.1.32206 WP_000907671.1.32252 WP_000907671.1.32255 WP_000907671.1.32260 WP_000907671.1.32274 WP_000907671.1.32275 WP_000907671.1.32277 WP_000907671.1.32309 WP_000907671.1.32357 WP_000907671.1.32408 WP_000907671.1.32423 WP_000907671.1.32424 WP_000907671.1.32434 WP_000907671.1.32438 WP_000907671.1.32459 WP_000907671.1.32515 WP_000907671.1.32519 WP_000907671.1.32527 WP_000907671.1.32624 WP_000907671.1.32629 WP_000907671.1.32643 WP_000907671.1.32660 WP_000907671.1.32668 WP_000907671.1.32702 WP_000907671.1.32714 WP_000907671.1.32740 WP_000907671.1.32747 WP_000907671.1.32750 WP_000907671.1.3278 WP_000907671.1.32786 WP_000907671.1.32804 WP_000907671.1.32832 WP_000907671.1.32881 WP_000907671.1.32899 WP_000907671.1.32900 WP_000907671.1.32902 WP_000907671.1.32907 WP_000907671.1.32977 WP_000907671.1.33010 WP_000907671.1.33030 WP_000907671.1.3304 WP_000907671.1.33078 WP_000907671.1.3310 WP_000907671.1.33114 WP_000907671.1.33127 WP_000907671.1.33143 WP_000907671.1.33144 WP_000907671.1.33160 WP_000907671.1.33248 WP_000907671.1.33253 WP_000907671.1.33261 WP_000907671.1.33270 WP_000907671.1.333 WP_000907671.1.33392 WP_000907671.1.33409 WP_000907671.1.33486 WP_000907671.1.33492 WP_000907671.1.335 WP_000907671.1.33553 WP_000907671.1.33580 WP_000907671.1.33586 WP_000907671.1.33592 WP_000907671.1.33609 WP_000907671.1.33629 WP_000907671.1.3364 WP_000907671.1.33659 WP_000907671.1.33817 WP_000907671.1.33825 WP_000907671.1.33870 WP_000907671.1.33894 WP_000907671.1.3394 WP_000907671.1.3395 WP_000907671.1.3396 WP_000907671.1.34022 WP_000907671.1.34043 WP_000907671.1.34075 WP_000907671.1.34081 WP_000907671.1.34084 WP_000907671.1.34091 WP_000907671.1.34107 WP_000907671.1.34126 WP_000907671.1.34179 WP_000907671.1.34184 WP_000907671.1.34185 WP_000907671.1.34257 WP_000907671.1.34279 WP_000907671.1.34292 WP_000907671.1.34304 WP_000907671.1.34319 WP_000907671.1.34330 WP_000907671.1.3438 WP_000907671.1.34417 WP_000907671.1.34431 WP_000907671.1.3445 WP_000907671.1.34453 WP_000907671.1.34496 WP_000907671.1.34610 WP_000907671.1.34614 WP_000907671.1.34647 WP_000907671.1.34659 WP_000907671.1.34667 WP_000907671.1.34704 WP_000907671.1.34711 WP_000907671.1.34745 WP_000907671.1.3476 WP_000907671.1.34817 WP_000907671.1.34820 WP_000907671.1.34856 WP_000907671.1.34881 WP_000907671.1.3489 WP_000907671.1.34975 WP_000907671.1.35035 WP_000907671.1.35075 WP_000907671.1.35125 WP_000907671.1.35129 WP_000907671.1.35184 WP_000907671.1.35193 WP_000907671.1.35219 WP_000907671.1.35294 WP_000907671.1.35298 WP_000907671.1.35321 WP_000907671.1.35404 WP_000907671.1.35408 WP_000907671.1.3541 WP_000907671.1.35425 WP_000907671.1.35429 WP_000907671.1.35446 WP_000907671.1.35460 WP_000907671.1.35463 WP_000907671.1.35494 WP_000907671.1.35503 WP_000907671.1.35509 WP_000907671.1.3556 WP_000907671.1.35563 WP_000907671.1.35570 WP_000907671.1.35590 WP_000907671.1.35594 WP_000907671.1.35624 WP_000907671.1.35648 WP_000907671.1.35809 WP_000907671.1.35835 WP_000907671.1.35868 WP_000907671.1.35887 WP_000907671.1.35892 WP_000907671.1.35936 WP_000907671.1.35940 WP_000907671.1.35961 WP_000907671.1.35993 WP_000907671.1.36003 WP_000907671.1.3601 WP_000907671.1.36011 WP_000907671.1.36017 WP_000907671.1.36037 WP_000907671.1.36063 WP_000907671.1.3610 WP_000907671.1.36157 WP_000907671.1.36229 WP_000907671.1.36232 WP_000907671.1.36236 WP_000907671.1.36286 WP_000907671.1.36409 WP_000907671.1.36445 WP_000907671.1.36512 WP_000907671.1.36547 WP_000907671.1.36564 WP_000907671.1.36584 WP_000907671.1.36592 WP_000907671.1.36609 WP_000907671.1.36652 WP_000907671.1.36685 WP_000907671.1.36690 WP_000907671.1.3670 WP_000907671.1.36705 WP_000907671.1.36721 WP_000907671.1.36751 WP_000907671.1.36764 WP_000907671.1.36765 WP_000907671.1.36792 WP_000907671.1.3688 WP_000907671.1.36885 WP_000907671.1.36889 WP_000907671.1.36899 WP_000907671.1.36918 WP_000907671.1.36931 WP_000907671.1.36949 WP_000907671.1.36978 WP_000907671.1.37013 WP_000907671.1.37021 WP_000907671.1.37028 WP_000907671.1.37029 WP_000907671.1.37063 WP_000907671.1.37073 WP_000907671.1.37100 WP_000907671.1.37111 WP_000907671.1.37112 WP_000907671.1.37114 WP_000907671.1.37147 WP_000907671.1.37158 WP_000907671.1.37190 WP_000907671.1.37191 WP_000907671.1.37256 WP_000907671.1.37267 WP_000907671.1.3728 WP_000907671.1.37293 WP_000907671.1.37297 WP_000907671.1.37351 WP_000907671.1.37363 WP_000907671.1.37370 WP_000907671.1.37376 WP_000907671.1.37405 WP_000907671.1.3744 WP_000907671.1.3748 WP_000907671.1.37498 WP_000907671.1.37504 WP_000907671.1.37558 WP_000907671.1.37610 WP_000907671.1.37618 WP_000907671.1.37666 WP_000907671.1.3771 WP_000907671.1.37719 WP_000907671.1.3778 WP_000907671.1.37808 WP_000907671.1.37848 WP_000907671.1.37864 WP_000907671.1.3790 WP_000907671.1.37965 WP_000907671.1.37968 WP_000907671.1.37978 WP_000907671.1.38001 WP_000907671.1.38026 WP_000907671.1.38037 WP_000907671.1.38047 WP_000907671.1.38055 WP_000907671.1.38113 WP_000907671.1.38125 WP_000907671.1.38145 WP_000907671.1.38199 WP_000907671.1.38273 WP_000907671.1.3828 WP_000907671.1.383 WP_000907671.1.38341 WP_000907671.1.38344 WP_000907671.1.38393 WP_000907671.1.38408 WP_000907671.1.3848 WP_000907671.1.38569 WP_000907671.1.38609 WP_000907671.1.38613 WP_000907671.1.38673 WP_000907671.1.38693 WP_000907671.1.38773 WP_000907671.1.38781 WP_000907671.1.38797 WP_000907671.1.38857 WP_000907671.1.38881 WP_000907671.1.38882 WP_000907671.1.38895 WP_000907671.1.38898 WP_000907671.1.3891 WP_000907671.1.38913 WP_000907671.1.38942 WP_000907671.1.38995 WP_000907671.1.39003 WP_000907671.1.39038 WP_000907671.1.39048 WP_000907671.1.39055 WP_000907671.1.39059 WP_000907671.1.39065 WP_000907671.1.39075 WP_000907671.1.39082 WP_000907671.1.39113 WP_000907671.1.39136 WP_000907671.1.39146 WP_000907671.1.39183 WP_000907671.1.39197 WP_000907671.1.39229 WP_000907671.1.39265 WP_000907671.1.39311 WP_000907671.1.39312 WP_000907671.1.39385 WP_000907671.1.39395 WP_000907671.1.39405 WP_000907671.1.39420 WP_000907671.1.39449 WP_000907671.1.39466 WP_000907671.1.39471 WP_000907671.1.39503 WP_000907671.1.39512 WP_000907671.1.39553 WP_000907671.1.39584 WP_000907671.1.39629 WP_000907671.1.39632 WP_000907671.1.39722 WP_000907671.1.39723 WP_000907671.1.39724 WP_000907671.1.39763 WP_000907671.1.39862 WP_000907671.1.39921 WP_000907671.1.39923 WP_000907671.1.40008 WP_000907671.1.40017 WP_000907671.1.40072 WP_000907671.1.40073 WP_000907671.1.40081 WP_000907671.1.4011 WP_000907671.1.40111 WP_000907671.1.40155 WP_000907671.1.40170 WP_000907671.1.40171 WP_000907671.1.40205 WP_000907671.1.40208 WP_000907671.1.40224 WP_000907671.1.40240 WP_000907671.1.40254 WP_000907671.1.40257 WP_000907671.1.40292 WP_000907671.1.40305 WP_000907671.1.40307 WP_000907671.1.40311 WP_000907671.1.40341 WP_000907671.1.40374 WP_000907671.1.40380 WP_000907671.1.40395 WP_000907671.1.40465 WP_000907671.1.40492 WP_000907671.1.40493 WP_000907671.1.40508 WP_000907671.1.40528 WP_000907671.1.40533 WP_000907671.1.40577 WP_000907671.1.40583 WP_000907671.1.40605 WP_000907671.1.40622 WP_000907671.1.40693 WP_000907671.1.40695 WP_000907671.1.40710 WP_000907671.1.40745 WP_000907671.1.4075 WP_000907671.1.40771 WP_000907671.1.40788 WP_000907671.1.40849 WP_000907671.1.4087 WP_000907671.1.40877 WP_000907671.1.4088 WP_000907671.1.40910 WP_000907671.1.40930 WP_000907671.1.40935 WP_000907671.1.40973 WP_000907671.1.40979 WP_000907671.1.40996 WP_000907671.1.41017 WP_000907671.1.41018 WP_000907671.1.41048 WP_000907671.1.41050 WP_000907671.1.41086 WP_000907671.1.4109 WP_000907671.1.41091 WP_000907671.1.41116 WP_000907671.1.41128 WP_000907671.1.41192 WP_000907671.1.41225 WP_000907671.1.41226 WP_000907671.1.41265 WP_000907671.1.41277 WP_000907671.1.41279 WP_000907671.1.41299 WP_000907671.1.41308 WP_000907671.1.41310 WP_000907671.1.41345 WP_000907671.1.41375 WP_000907671.1.41427 WP_000907671.1.41438 WP_000907671.1.41440 WP_000907671.1.41468 WP_000907671.1.41516 WP_000907671.1.41528 WP_000907671.1.41554 WP_000907671.1.41572 WP_000907671.1.41591 WP_000907671.1.41593 WP_000907671.1.41610 WP_000907671.1.41628 WP_000907671.1.41662 WP_000907671.1.41690 WP_000907671.1.41708 WP_000907671.1.41761 WP_000907671.1.4178 WP_000907671.1.41789 WP_000907671.1.41799 WP_000907671.1.4184 WP_000907671.1.41862 WP_000907671.1.41882 WP_000907671.1.41897 WP_000907671.1.41911 WP_000907671.1.41931 WP_000907671.1.41938 WP_000907671.1.41949 WP_000907671.1.41978 WP_000907671.1.41979 WP_000907671.1.41985 WP_000907671.1.41994 WP_000907671.1.42104 WP_000907671.1.42136 WP_000907671.1.42156 WP_000907671.1.422 WP_000907671.1.4222 WP_000907671.1.42243 WP_000907671.1.42262 WP_000907671.1.42263 WP_000907671.1.42276 WP_000907671.1.42320 WP_000907671.1.42322 WP_000907671.1.42328 WP_000907671.1.42342 WP_000907671.1.42356 WP_000907671.1.4239 WP_000907671.1.42392 WP_000907671.1.42422 WP_000907671.1.42444 WP_000907671.1.42453 WP_000907671.1.42489 WP_000907671.1.42491 WP_000907671.1.4257 WP_000907671.1.42666 WP_000907671.1.42675 WP_000907671.1.42676 WP_000907671.1.42683 WP_000907671.1.42685 WP_000907671.1.42707 WP_000907671.1.42734 WP_000907671.1.4276 WP_000907671.1.42767 WP_000907671.1.42829 WP_000907671.1.42861 WP_000907671.1.42864 WP_000907671.1.4288 WP_000907671.1.42887 WP_000907671.1.4289 WP_000907671.1.42932 WP_000907671.1.42957 WP_000907671.1.42978 WP_000907671.1.42981 WP_000907671.1.43018 WP_000907671.1.43041 WP_000907671.1.43070 WP_000907671.1.43077 WP_000907671.1.43086 WP_000907671.1.43089 WP_000907671.1.43126 WP_000907671.1.43149 WP_000907671.1.43160 WP_000907671.1.43201 WP_000907671.1.43244 WP_000907671.1.43258 WP_000907671.1.43272 WP_000907671.1.43299 WP_000907671.1.43312 WP_000907671.1.4332 WP_000907671.1.43334 WP_000907671.1.43339 WP_000907671.1.43371 WP_000907671.1.43437 WP_000907671.1.43438 WP_000907671.1.4344 WP_000907671.1.43476 WP_000907671.1.43522 WP_000907671.1.43528 WP_000907671.1.43535 WP_000907671.1.43606 WP_000907671.1.43613 WP_000907671.1.43654 WP_000907671.1.43668 WP_000907671.1.43676 WP_000907671.1.43685 WP_000907671.1.43710 WP_000907671.1.43711 WP_000907671.1.4373 WP_000907671.1.43763 WP_000907671.1.43778 WP_000907671.1.43785 WP_000907671.1.43828 WP_000907671.1.43864 WP_000907671.1.43873 WP_000907671.1.43875 WP_000907671.1.43886 WP_000907671.1.43951 WP_000907671.1.43954 WP_000907671.1.44005 WP_000907671.1.44010 WP_000907671.1.4404 WP_000907671.1.44043 WP_000907671.1.44063 WP_000907671.1.44099 WP_000907671.1.44113 WP_000907671.1.44121 WP_000907671.1.44132 WP_000907671.1.44191 WP_000907671.1.4422 WP_000907671.1.4423 WP_000907671.1.44250 WP_000907671.1.44291 WP_000907671.1.44300 WP_000907671.1.44310 WP_000907671.1.44337 WP_000907671.1.44339 WP_000907671.1.44359 WP_000907671.1.44380 WP_000907671.1.44386 WP_000907671.1.4440 WP_000907671.1.44433 WP_000907671.1.44438 WP_000907671.1.44440 WP_000907671.1.44453 WP_000907671.1.44474 WP_000907671.1.44479 WP_000907671.1.44549 WP_000907671.1.44607 WP_000907671.1.44636 WP_000907671.1.44640 WP_000907671.1.4467 WP_000907671.1.44705 WP_000907671.1.44747 WP_000907671.1.44781 WP_000907671.1.44791 WP_000907671.1.44795 WP_000907671.1.44831 WP_000907671.1.4485 WP_000907671.1.44877 WP_000907671.1.44927 WP_000907671.1.44933 WP_000907671.1.44966 WP_000907671.1.44978 WP_000907671.1.44985 WP_000907671.1.44996 WP_000907671.1.44997 WP_000907671.1.4500 WP_000907671.1.45038 WP_000907671.1.45045 WP_000907671.1.45067 WP_000907671.1.45074 WP_000907671.1.45079 WP_000907671.1.45098 WP_000907671.1.45123 WP_000907671.1.45134 WP_000907671.1.45138 WP_000907671.1.45145 WP_000907671.1.45154 WP_000907671.1.45173 WP_000907671.1.45177 WP_000907671.1.45184 WP_000907671.1.45251 WP_000907671.1.45259 WP_000907671.1.45268 WP_000907671.1.4531 WP_000907671.1.45322 WP_000907671.1.45344 WP_000907671.1.45349 WP_000907671.1.45351 WP_000907671.1.45365 WP_000907671.1.45402 WP_000907671.1.45432 WP_000907671.1.45434 WP_000907671.1.45462 WP_000907671.1.45522 WP_000907671.1.45535 WP_000907671.1.45544 WP_000907671.1.45549 WP_000907671.1.45550 WP_000907671.1.45566 WP_000907671.1.45571 WP_000907671.1.45582 WP_000907671.1.45583 WP_000907671.1.45585 WP_000907671.1.45622 WP_000907671.1.45660 WP_000907671.1.45690 WP_000907671.1.45706 WP_000907671.1.458 WP_000907671.1.45844 WP_000907671.1.45848 WP_000907671.1.45906 WP_000907671.1.45918 WP_000907671.1.45984 WP_000907671.1.46011 WP_000907671.1.46028 WP_000907671.1.46069 WP_000907671.1.46091 WP_000907671.1.46112 WP_000907671.1.46173 WP_000907671.1.46174 WP_000907671.1.46187 WP_000907671.1.46203 WP_000907671.1.46215 WP_000907671.1.46232 WP_000907671.1.46243 WP_000907671.1.46250 WP_000907671.1.46278 WP_000907671.1.46286 WP_000907671.1.46299 WP_000907671.1.46303 WP_000907671.1.46322 WP_000907671.1.46345 WP_000907671.1.46358 WP_000907671.1.46434 WP_000907671.1.46499 WP_000907671.1.46574 WP_000907671.1.46578 WP_000907671.1.46595 WP_000907671.1.46620 WP_000907671.1.46637 WP_000907671.1.46666 WP_000907671.1.46675 WP_000907671.1.46689 WP_000907671.1.46693 WP_000907671.1.46726 WP_000907671.1.46730 WP_000907671.1.46732 WP_000907671.1.4674 WP_000907671.1.46749 WP_000907671.1.46803 WP_000907671.1.46804 WP_000907671.1.4686 WP_000907671.1.46930 WP_000907671.1.46961 WP_000907671.1.46967 WP_000907671.1.46976 WP_000907671.1.47005 WP_000907671.1.47008 WP_000907671.1.47014 WP_000907671.1.47057 WP_000907671.1.47058 WP_000907671.1.47067 WP_000907671.1.47214 WP_000907671.1.47257 WP_000907671.1.47389 WP_000907671.1.47429 WP_000907671.1.47442 WP_000907671.1.47448 WP_000907671.1.47460 WP_000907671.1.4747 WP_000907671.1.47472 WP_000907671.1.47492 WP_000907671.1.47507 WP_000907671.1.47567 WP_000907671.1.47576 WP_000907671.1.47579 WP_000907671.1.4758 WP_000907671.1.47587 WP_000907671.1.47614 WP_000907671.1.47621 WP_000907671.1.47649 WP_000907671.1.4769 WP_000907671.1.47714 WP_000907671.1.4775 WP_000907671.1.47767 WP_000907671.1.47799 WP_000907671.1.47814 WP_000907671.1.47817 WP_000907671.1.47829 WP_000907671.1.47849 WP_000907671.1.47850 WP_000907671.1.47875 WP_000907671.1.47902 WP_000907671.1.47911 WP_000907671.1.47928 WP_000907671.1.4795 WP_000907671.1.47988 WP_000907671.1.48124 WP_000907671.1.48132 WP_000907671.1.48209 WP_000907671.1.48215 WP_000907671.1.48218 WP_000907671.1.48242 WP_000907671.1.48244 WP_000907671.1.48247 WP_000907671.1.48253 WP_000907671.1.48262 WP_000907671.1.483 WP_000907671.1.48367 WP_000907671.1.48377 WP_000907671.1.4839 WP_000907671.1.48399 WP_000907671.1.48455 WP_000907671.1.48493 WP_000907671.1.4853 WP_000907671.1.48570 WP_000907671.1.48647 WP_000907671.1.48651 WP_000907671.1.48751 WP_000907671.1.48774 WP_000907671.1.48788 WP_000907671.1.48797 WP_000907671.1.4885 WP_000907671.1.48876 WP_000907671.1.48886 WP_000907671.1.48894 WP_000907671.1.48896 WP_000907671.1.48908 WP_000907671.1.48919 WP_000907671.1.48985 WP_000907671.1.49005 WP_000907671.1.49084 WP_000907671.1.49090 WP_000907671.1.49102 WP_000907671.1.49113 WP_000907671.1.49155 WP_000907671.1.49162 WP_000907671.1.49175 WP_000907671.1.49204 WP_000907671.1.49214 WP_000907671.1.49226 WP_000907671.1.49233 WP_000907671.1.49239 WP_000907671.1.49256 WP_000907671.1.49262 WP_000907671.1.49276 WP_000907671.1.49290 WP_000907671.1.49304 WP_000907671.1.49309 WP_000907671.1.49311 WP_000907671.1.49334 WP_000907671.1.49340 WP_000907671.1.49358 WP_000907671.1.49366 WP_000907671.1.49375 WP_000907671.1.49443 WP_000907671.1.49472 WP_000907671.1.49490 WP_000907671.1.49515 WP_000907671.1.49550 WP_000907671.1.49572 WP_000907671.1.49574 WP_000907671.1.49590 WP_000907671.1.49595 WP_000907671.1.49602 WP_000907671.1.49626 WP_000907671.1.49630 WP_000907671.1.49647 WP_000907671.1.49650 WP_000907671.1.49686 WP_000907671.1.49770 WP_000907671.1.49778 WP_000907671.1.4979 WP_000907671.1.49803 WP_000907671.1.49805 WP_000907671.1.49827 WP_000907671.1.49848 WP_000907671.1.49929 WP_000907671.1.49931 WP_000907671.1.50007 WP_000907671.1.50080 WP_000907671.1.5009 WP_000907671.1.50128 WP_000907671.1.50161 WP_000907671.1.50198 WP_000907671.1.50211 WP_000907671.1.50238 WP_000907671.1.50239 WP_000907671.1.50285 WP_000907671.1.50332 WP_000907671.1.50349 WP_000907671.1.50374 WP_000907671.1.50376 WP_000907671.1.50386 WP_000907671.1.50389 WP_000907671.1.50404 WP_000907671.1.50413 WP_000907671.1.50449 WP_000907671.1.50469 WP_000907671.1.50478 WP_000907671.1.50480 WP_000907671.1.50517 WP_000907671.1.50563 WP_000907671.1.50565 WP_000907671.1.50576 WP_000907671.1.5058 WP_000907671.1.50593 WP_000907671.1.50676 WP_000907671.1.50684 WP_000907671.1.50769 WP_000907671.1.50774 WP_000907671.1.50782 WP_000907671.1.50804 WP_000907671.1.50808 WP_000907671.1.5088 WP_000907671.1.50882 WP_000907671.1.50893 WP_000907671.1.50908 WP_000907671.1.50918 WP_000907671.1.50941 WP_000907671.1.50960 WP_000907671.1.50999 WP_000907671.1.51014 WP_000907671.1.51022 WP_000907671.1.51025 WP_000907671.1.51036 WP_000907671.1.51066 WP_000907671.1.51131 WP_000907671.1.51139 WP_000907671.1.5114 WP_000907671.1.51178 WP_000907671.1.51179 WP_000907671.1.51182 WP_000907671.1.51186 WP_000907671.1.51224 WP_000907671.1.5125 WP_000907671.1.51331 WP_000907671.1.51356 WP_000907671.1.5138 WP_000907671.1.51394 WP_000907671.1.51412 WP_000907671.1.51414 WP_000907671.1.51419 WP_000907671.1.51451 WP_000907671.1.51464 WP_000907671.1.51487 WP_000907671.1.51488 WP_000907671.1.51502 WP_000907671.1.51506 WP_000907671.1.51518 WP_000907671.1.51555 WP_000907671.1.51594 WP_000907671.1.51613 WP_000907671.1.51615 WP_000907671.1.51634 WP_000907671.1.51642 WP_000907671.1.51649 WP_000907671.1.51686 WP_000907671.1.51700 WP_000907671.1.51704 WP_000907671.1.51756 WP_000907671.1.51810 WP_000907671.1.51831 WP_000907671.1.51841 WP_000907671.1.51868 WP_000907671.1.51888 WP_000907671.1.51900 WP_000907671.1.51910 WP_000907671.1.51911 WP_000907671.1.51914 WP_000907671.1.51930 WP_000907671.1.51932 WP_000907671.1.51989 WP_000907671.1.51994 WP_000907671.1.520 WP_000907671.1.5211 WP_000907671.1.52121 WP_000907671.1.52156 WP_000907671.1.5216 WP_000907671.1.52161 WP_000907671.1.52170 WP_000907671.1.52255 WP_000907671.1.52301 WP_000907671.1.52321 WP_000907671.1.52336 WP_000907671.1.52346 WP_000907671.1.52353 WP_000907671.1.52356 WP_000907671.1.52361 WP_000907671.1.52438 WP_000907671.1.52446 WP_000907671.1.52456 WP_000907671.1.52527 WP_000907671.1.52582 WP_000907671.1.52586 WP_000907671.1.52637 WP_000907671.1.52653 WP_000907671.1.52656 WP_000907671.1.52675 WP_000907671.1.52692 WP_000907671.1.5273 WP_000907671.1.52738 WP_000907671.1.52743 WP_000907671.1.52748 WP_000907671.1.52824 WP_000907671.1.52833 WP_000907671.1.52851 WP_000907671.1.52857 WP_000907671.1.52866 WP_000907671.1.52898 WP_000907671.1.52915 WP_000907671.1.52924 WP_000907671.1.52949 WP_000907671.1.52985 WP_000907671.1.5301 WP_000907671.1.53016 WP_000907671.1.53100 WP_000907671.1.53107 WP_000907671.1.53119 WP_000907671.1.5313 WP_000907671.1.5316 WP_000907671.1.53179 WP_000907671.1.53190 WP_000907671.1.53206 WP_000907671.1.53234 WP_000907671.1.53272 WP_000907671.1.53274 WP_000907671.1.53286 WP_000907671.1.53315 WP_000907671.1.53316 WP_000907671.1.53328 WP_000907671.1.53362 WP_000907671.1.53385 WP_000907671.1.53406 WP_000907671.1.53454 WP_000907671.1.53466 WP_000907671.1.53529 WP_000907671.1.53543 WP_000907671.1.53567 WP_000907671.1.53664 WP_000907671.1.53688 WP_000907671.1.53694 WP_000907671.1.53696 WP_000907671.1.53757 WP_000907671.1.53772 WP_000907671.1.53778 WP_000907671.1.53781 WP_000907671.1.53790 WP_000907671.1.53812 WP_000907671.1.53814 WP_000907671.1.53905 WP_000907671.1.5392 WP_000907671.1.53935 WP_000907671.1.53961 WP_000907671.1.54033 WP_000907671.1.54061 WP_000907671.1.54075 WP_000907671.1.54082 WP_000907671.1.54085 WP_000907671.1.54136 WP_000907671.1.5415 WP_000907671.1.54196 WP_000907671.1.54209 WP_000907671.1.54271 WP_000907671.1.54274 WP_000907671.1.54283 WP_000907671.1.54319 WP_000907671.1.54324 WP_000907671.1.54333 WP_000907671.1.54364 WP_000907671.1.54366 WP_000907671.1.54400 WP_000907671.1.54500 WP_000907671.1.54526 WP_000907671.1.54558 WP_000907671.1.54569 WP_000907671.1.5459 WP_000907671.1.54607 WP_000907671.1.54615 WP_000907671.1.54644 WP_000907671.1.54662 WP_000907671.1.54694 WP_000907671.1.54722 WP_000907671.1.54749 WP_000907671.1.54764 WP_000907671.1.54774 WP_000907671.1.54822 WP_000907671.1.54827 WP_000907671.1.54833 WP_000907671.1.5485 WP_000907671.1.54877 WP_000907671.1.5493 WP_000907671.1.54936 WP_000907671.1.54984 WP_000907671.1.55008 WP_000907671.1.55152 WP_000907671.1.55156 WP_000907671.1.55166 WP_000907671.1.5517 WP_000907671.1.55178 WP_000907671.1.55223 WP_000907671.1.55224 WP_000907671.1.5523 WP_000907671.1.5525 WP_000907671.1.55285 WP_000907671.1.55294 WP_000907671.1.55325 WP_000907671.1.55361 WP_000907671.1.55418 WP_000907671.1.55430 WP_000907671.1.55461 WP_000907671.1.55475 WP_000907671.1.55477 WP_000907671.1.55496 WP_000907671.1.5552 WP_000907671.1.55528 WP_000907671.1.5555 WP_000907671.1.55554 WP_000907671.1.55559 WP_000907671.1.5560 WP_000907671.1.55614 WP_000907671.1.55623 WP_000907671.1.55640 WP_000907671.1.55647 WP_000907671.1.55680 WP_000907671.1.55706 WP_000907671.1.55718 WP_000907671.1.5572 WP_000907671.1.55743 WP_000907671.1.55768 WP_000907671.1.5577 WP_000907671.1.55782 WP_000907671.1.55796 WP_000907671.1.55803 WP_000907671.1.55923 WP_000907671.1.55948 WP_000907671.1.55973 WP_000907671.1.55995 WP_000907671.1.56002 WP_000907671.1.56004 WP_000907671.1.56012 WP_000907671.1.56069 WP_000907671.1.56082 WP_000907671.1.56097 WP_000907671.1.56100 WP_000907671.1.56105 WP_000907671.1.56130 WP_000907671.1.56152 WP_000907671.1.56222 WP_000907671.1.56238 WP_000907671.1.56244 WP_000907671.1.56247 WP_000907671.1.56261 WP_000907671.1.56263 WP_000907671.1.56286 WP_000907671.1.56303 WP_000907671.1.56304 WP_000907671.1.56305 WP_000907671.1.5633 WP_000907671.1.56354 WP_000907671.1.56368 WP_000907671.1.56370 WP_000907671.1.56385 WP_000907671.1.56389 WP_000907671.1.56396 WP_000907671.1.56413 WP_000907671.1.56414 WP_000907671.1.56420 WP_000907671.1.56438 WP_000907671.1.56468 WP_000907671.1.56559 WP_000907671.1.56560 WP_000907671.1.56597 WP_000907671.1.56601 WP_000907671.1.56614 WP_000907671.1.56615 WP_000907671.1.56642 WP_000907671.1.56651 WP_000907671.1.56660 WP_000907671.1.56671 WP_000907671.1.5668 WP_000907671.1.56682 WP_000907671.1.56824 WP_000907671.1.56851 WP_000907671.1.56853 WP_000907671.1.56861 WP_000907671.1.56875 WP_000907671.1.56877 WP_000907671.1.56893 WP_000907671.1.56898 WP_000907671.1.57026 WP_000907671.1.57039 WP_000907671.1.57056 WP_000907671.1.57076 WP_000907671.1.57084 WP_000907671.1.5711 WP_000907671.1.57125 WP_000907671.1.57143 WP_000907671.1.57168 WP_000907671.1.57187 WP_000907671.1.57233 WP_000907671.1.57296 WP_000907671.1.57307 WP_000907671.1.57344 WP_000907671.1.57356 WP_000907671.1.57357 WP_000907671.1.57362 WP_000907671.1.57377 WP_000907671.1.57399 WP_000907671.1.57418 WP_000907671.1.57433 WP_000907671.1.57495 WP_000907671.1.57510 WP_000907671.1.57515 WP_000907671.1.57521 WP_000907671.1.57529 WP_000907671.1.5753 WP_000907671.1.57534 WP_000907671.1.57555 WP_000907671.1.57559 WP_000907671.1.57576 WP_000907671.1.57601 WP_000907671.1.57607 WP_000907671.1.57631 WP_000907671.1.57641 WP_000907671.1.57710 WP_000907671.1.57735 WP_000907671.1.5774 WP_000907671.1.57763 WP_000907671.1.57778 WP_000907671.1.57781 WP_000907671.1.57797 WP_000907671.1.5781 WP_000907671.1.57835 WP_000907671.1.57857 WP_000907671.1.57862 WP_000907671.1.57890 WP_000907671.1.57891 WP_000907671.1.57893 WP_000907671.1.57978 WP_000907671.1.5801 WP_000907671.1.58040 WP_000907671.1.58041 WP_000907671.1.58090 WP_000907671.1.58131 WP_000907671.1.58144 WP_000907671.1.58157 WP_000907671.1.58239 WP_000907671.1.58251 WP_000907671.1.5828 WP_000907671.1.58290 WP_000907671.1.58301 WP_000907671.1.58334 WP_000907671.1.58358 WP_000907671.1.58372 WP_000907671.1.58407 WP_000907671.1.58416 WP_000907671.1.58418 WP_000907671.1.58442 WP_000907671.1.58443 WP_000907671.1.58451 WP_000907671.1.58486 WP_000907671.1.58489 WP_000907671.1.58548 WP_000907671.1.58564 WP_000907671.1.5858 WP_000907671.1.58604 WP_000907671.1.58633 WP_000907671.1.58662 WP_000907671.1.58669 WP_000907671.1.58675 WP_000907671.1.587 WP_000907671.1.58729 WP_000907671.1.58744 WP_000907671.1.58745 WP_000907671.1.5878 WP_000907671.1.58803 WP_000907671.1.58831 WP_000907671.1.58834 WP_000907671.1.58836 WP_000907671.1.5886 WP_000907671.1.58884 WP_000907671.1.58926 WP_000907671.1.58932 WP_000907671.1.59006 WP_000907671.1.59012 WP_000907671.1.59084 WP_000907671.1.59094 WP_000907671.1.59097 WP_000907671.1.59125 WP_000907671.1.59136 WP_000907671.1.59142 WP_000907671.1.59148 WP_000907671.1.59163 WP_000907671.1.59224 WP_000907671.1.59236 WP_000907671.1.5929 WP_000907671.1.59295 WP_000907671.1.59321 WP_000907671.1.59336 WP_000907671.1.59375 WP_000907671.1.59381 WP_000907671.1.59420 WP_000907671.1.59427 WP_000907671.1.59439 WP_000907671.1.59458 WP_000907671.1.59486 WP_000907671.1.59490 WP_000907671.1.59508 WP_000907671.1.59512 WP_000907671.1.59521 WP_000907671.1.59538 WP_000907671.1.59548 WP_000907671.1.59562 WP_000907671.1.59587 WP_000907671.1.59604 WP_000907671.1.59641 WP_000907671.1.59646 WP_000907671.1.59648 WP_000907671.1.59684 WP_000907671.1.59694 WP_000907671.1.59710 WP_000907671.1.59755 WP_000907671.1.59771 WP_000907671.1.5979 WP_000907671.1.59830 WP_000907671.1.59848 WP_000907671.1.59928 WP_000907671.1.5993 WP_000907671.1.59933 WP_000907671.1.59953 WP_000907671.1.59979 WP_000907671.1.60004 WP_000907671.1.60008 WP_000907671.1.60021 WP_000907671.1.60052 WP_000907671.1.60069 WP_000907671.1.60106 WP_000907671.1.60126 WP_000907671.1.60137 WP_000907671.1.60140 WP_000907671.1.60155 WP_000907671.1.60213 WP_000907671.1.60226 WP_000907671.1.60231 WP_000907671.1.60285 WP_000907671.1.60320 WP_000907671.1.6033 WP_000907671.1.60330 WP_000907671.1.60370 WP_000907671.1.60379 WP_000907671.1.60425 WP_000907671.1.60464 WP_000907671.1.60469 WP_000907671.1.60503 WP_000907671.1.60507 WP_000907671.1.6052 WP_000907671.1.60545 WP_000907671.1.60560 WP_000907671.1.60561 WP_000907671.1.60597 WP_000907671.1.60608 WP_000907671.1.60622 WP_000907671.1.60643 WP_000907671.1.60661 WP_000907671.1.60713 WP_000907671.1.60746 WP_000907671.1.60760 WP_000907671.1.60772 WP_000907671.1.60794 WP_000907671.1.608 WP_000907671.1.60838 WP_000907671.1.60851 WP_000907671.1.60855 WP_000907671.1.60857 WP_000907671.1.60863 WP_000907671.1.60866 WP_000907671.1.60874 WP_000907671.1.60897 WP_000907671.1.6090 WP_000907671.1.60919 WP_000907671.1.60941 WP_000907671.1.60988 WP_000907671.1.60990 WP_000907671.1.61045 WP_000907671.1.61078 WP_000907671.1.6108 WP_000907671.1.61087 WP_000907671.1.61114 WP_000907671.1.6114 WP_000907671.1.61146 WP_000907671.1.61184 WP_000907671.1.61200 WP_000907671.1.61201 WP_000907671.1.61218 WP_000907671.1.61232 WP_000907671.1.61233 WP_000907671.1.6129 WP_000907671.1.61296 WP_000907671.1.61345 WP_000907671.1.61356 WP_000907671.1.61381 WP_000907671.1.61417 WP_000907671.1.61434 WP_000907671.1.61497 WP_000907671.1.61501 WP_000907671.1.61509 WP_000907671.1.61519 WP_000907671.1.61574 WP_000907671.1.61594 WP_000907671.1.61595 WP_000907671.1.61609 WP_000907671.1.6164 WP_000907671.1.61662 WP_000907671.1.61667 WP_000907671.1.61671 WP_000907671.1.61712 WP_000907671.1.61714 WP_000907671.1.61730 WP_000907671.1.61732 WP_000907671.1.61737 WP_000907671.1.61783 WP_000907671.1.61857 WP_000907671.1.6190 WP_000907671.1.61908 WP_000907671.1.61918 WP_000907671.1.61922 WP_000907671.1.61924 WP_000907671.1.61952 WP_000907671.1.62007 WP_000907671.1.62020 WP_000907671.1.62025 WP_000907671.1.62076 WP_000907671.1.6209 WP_000907671.1.6210 WP_000907671.1.62108 WP_000907671.1.62142 WP_000907671.1.62144 WP_000907671.1.62158 WP_000907671.1.62184 WP_000907671.1.62201 WP_000907671.1.62204 WP_000907671.1.62210 WP_000907671.1.62219 WP_000907671.1.62222 WP_000907671.1.62241 WP_000907671.1.62257 WP_000907671.1.62304 WP_000907671.1.62310 WP_000907671.1.62344 WP_000907671.1.62364 WP_000907671.1.62374 WP_000907671.1.62403 WP_000907671.1.62412 WP_000907671.1.62486 WP_000907671.1.62488 WP_000907671.1.62504 WP_000907671.1.6253 WP_000907671.1.62564 WP_000907671.1.62619 WP_000907671.1.62677 WP_000907671.1.62693 WP_000907671.1.627 WP_000907671.1.62725 WP_000907671.1.62745 WP_000907671.1.62757 WP_000907671.1.62798 WP_000907671.1.62828 WP_000907671.1.62853 WP_000907671.1.62903 WP_000907671.1.62910 WP_000907671.1.6292 WP_000907671.1.62955 WP_000907671.1.62983 WP_000907671.1.62988 WP_000907671.1.63043 WP_000907671.1.63045 WP_000907671.1.63102 WP_000907671.1.63118 WP_000907671.1.63129 WP_000907671.1.63135 WP_000907671.1.63150 WP_000907671.1.63181 WP_000907671.1.63203 WP_000907671.1.63234 WP_000907671.1.63243 WP_000907671.1.63250 WP_000907671.1.63256 WP_000907671.1.63290 WP_000907671.1.63358 WP_000907671.1.63382 WP_000907671.1.63422 WP_000907671.1.63432 WP_000907671.1.63461 WP_000907671.1.63479 WP_000907671.1.63497 WP_000907671.1.63499 WP_000907671.1.63513 WP_000907671.1.63525 WP_000907671.1.63529 WP_000907671.1.63532 WP_000907671.1.63568 WP_000907671.1.63577 WP_000907671.1.63603 WP_000907671.1.63633 WP_000907671.1.63664 WP_000907671.1.6367 WP_000907671.1.63677 WP_000907671.1.63690 WP_000907671.1.6370 WP_000907671.1.63718 WP_000907671.1.63731 WP_000907671.1.63748 WP_000907671.1.6375 WP_000907671.1.63757 WP_000907671.1.63766 WP_000907671.1.63781 WP_000907671.1.63782 WP_000907671.1.63797 WP_000907671.1.63824 WP_000907671.1.63834 WP_000907671.1.63851 WP_000907671.1.63860 WP_000907671.1.63863 WP_000907671.1.63864 WP_000907671.1.63866 WP_000907671.1.63903 WP_000907671.1.63912 WP_000907671.1.63934 WP_000907671.1.63958 WP_000907671.1.63977 WP_000907671.1.6399 WP_000907671.1.63992 WP_000907671.1.64007 WP_000907671.1.64018 WP_000907671.1.64034 WP_000907671.1.64046 WP_000907671.1.64072 WP_000907671.1.64085 WP_000907671.1.64109 WP_000907671.1.64157 WP_000907671.1.64208 WP_000907671.1.64217 WP_000907671.1.64229 WP_000907671.1.6423 WP_000907671.1.64242 WP_000907671.1.64244 WP_000907671.1.64294 WP_000907671.1.64374 WP_000907671.1.64385 WP_000907671.1.64387 WP_000907671.1.64389 WP_000907671.1.64403 WP_000907671.1.64412 WP_000907671.1.64462 WP_000907671.1.64500 WP_000907671.1.6451 WP_000907671.1.64569 WP_000907671.1.64597 WP_000907671.1.64645 WP_000907671.1.64649 WP_000907671.1.64667 WP_000907671.1.64674 WP_000907671.1.64702 WP_000907671.1.64711 WP_000907671.1.64757 WP_000907671.1.64771 WP_000907671.1.64781 WP_000907671.1.64798 WP_000907671.1.64831 WP_000907671.1.6489 WP_000907671.1.64894 WP_000907671.1.64920 WP_000907671.1.64944 WP_000907671.1.64972 WP_000907671.1.65011 WP_000907671.1.65016 WP_000907671.1.65018 WP_000907671.1.65022 WP_000907671.1.65027 WP_000907671.1.65028 WP_000907671.1.65052 WP_000907671.1.65163 WP_000907671.1.65168 WP_000907671.1.65171 WP_000907671.1.65185 WP_000907671.1.65238 WP_000907671.1.65248 WP_000907671.1.6525 WP_000907671.1.65269 WP_000907671.1.6535 WP_000907671.1.65357 WP_000907671.1.65363 WP_000907671.1.65394 WP_000907671.1.65474 WP_000907671.1.6550 WP_000907671.1.65508 WP_000907671.1.65538 WP_000907671.1.65558 WP_000907671.1.6560 WP_000907671.1.65601 WP_000907671.1.6561 WP_000907671.1.65633 WP_000907671.1.6565 WP_000907671.1.65687 WP_000907671.1.65696 WP_000907671.1.65698 WP_000907671.1.6575 WP_000907671.1.65771 WP_000907671.1.65782 WP_000907671.1.65790 WP_000907671.1.65849 WP_000907671.1.65876 WP_000907671.1.65881 WP_000907671.1.65883 WP_000907671.1.65901 WP_000907671.1.65940 WP_000907671.1.6595 WP_000907671.1.65956 WP_000907671.1.65968 WP_000907671.1.66049 WP_000907671.1.66074 WP_000907671.1.66082 WP_000907671.1.66085 WP_000907671.1.66129 WP_000907671.1.66167 WP_000907671.1.66171 WP_000907671.1.66250 WP_000907671.1.66270 WP_000907671.1.6630 WP_000907671.1.66314 WP_000907671.1.66315 WP_000907671.1.66330 WP_000907671.1.66358 WP_000907671.1.66362 WP_000907671.1.66365 WP_000907671.1.6638 WP_000907671.1.66385 WP_000907671.1.6640 WP_000907671.1.66400 WP_000907671.1.66428 WP_000907671.1.66446 WP_000907671.1.66462 WP_000907671.1.6647 WP_000907671.1.66492 WP_000907671.1.66534 WP_000907671.1.66539 WP_000907671.1.66600 WP_000907671.1.66630 WP_000907671.1.66678 WP_000907671.1.66698 WP_000907671.1.66702 WP_000907671.1.66733 WP_000907671.1.66779 WP_000907671.1.6680 WP_000907671.1.66800 WP_000907671.1.66807 WP_000907671.1.66824 WP_000907671.1.66834 WP_000907671.1.66876 WP_000907671.1.66901 WP_000907671.1.6692 WP_000907671.1.66959 WP_000907671.1.66962 WP_000907671.1.67037 WP_000907671.1.67045 WP_000907671.1.67075 WP_000907671.1.6710 WP_000907671.1.67100 WP_000907671.1.67173 WP_000907671.1.67175 WP_000907671.1.67181 WP_000907671.1.67184 WP_000907671.1.67235 WP_000907671.1.67268 WP_000907671.1.67279 WP_000907671.1.67288 WP_000907671.1.67347 WP_000907671.1.67374 WP_000907671.1.6739 WP_000907671.1.67405 WP_000907671.1.67465 WP_000907671.1.67552 WP_000907671.1.6760 WP_000907671.1.67603 WP_000907671.1.67637 WP_000907671.1.67682 WP_000907671.1.67707 WP_000907671.1.67731 WP_000907671.1.67772 WP_000907671.1.67814 WP_000907671.1.6782 WP_000907671.1.67829 WP_000907671.1.6785 WP_000907671.1.67887 WP_000907671.1.67905 WP_000907671.1.67932 WP_000907671.1.67942 WP_000907671.1.67969 WP_000907671.1.67970 WP_000907671.1.67977 WP_000907671.1.67988 WP_000907671.1.68036 WP_000907671.1.68073 WP_000907671.1.68075 WP_000907671.1.68115 WP_000907671.1.68140 WP_000907671.1.68147 WP_000907671.1.68159 WP_000907671.1.68167 WP_000907671.1.68201 WP_000907671.1.68206 WP_000907671.1.68210 WP_000907671.1.6827 WP_000907671.1.68275 WP_000907671.1.6833 WP_000907671.1.68401 WP_000907671.1.68477 WP_000907671.1.68478 WP_000907671.1.6849 WP_000907671.1.685 WP_000907671.1.68532 WP_000907671.1.68547 WP_000907671.1.6857 WP_000907671.1.6858 WP_000907671.1.68589 WP_000907671.1.68591 WP_000907671.1.68629 WP_000907671.1.68652 WP_000907671.1.68655 WP_000907671.1.68656 WP_000907671.1.68658 WP_000907671.1.68677 WP_000907671.1.6869 WP_000907671.1.68690 WP_000907671.1.6875 WP_000907671.1.68778 WP_000907671.1.68787 WP_000907671.1.68818 WP_000907671.1.6883 WP_000907671.1.68893 WP_000907671.1.68894 WP_000907671.1.68895 WP_000907671.1.68928 WP_000907671.1.68958 WP_000907671.1.68966 WP_000907671.1.68975 WP_000907671.1.69001 WP_000907671.1.69006 WP_000907671.1.69011 WP_000907671.1.69029 WP_000907671.1.6904 WP_000907671.1.6905 WP_000907671.1.69058 WP_000907671.1.6907 WP_000907671.1.69080 WP_000907671.1.69086 WP_000907671.1.6913 WP_000907671.1.69131 WP_000907671.1.69146 WP_000907671.1.69151 WP_000907671.1.69236 WP_000907671.1.69255 WP_000907671.1.69273 WP_000907671.1.69296 WP_000907671.1.69320 WP_000907671.1.69346 WP_000907671.1.69357 WP_000907671.1.69359 WP_000907671.1.69371 WP_000907671.1.69385 WP_000907671.1.69397 WP_000907671.1.69465 WP_000907671.1.69485 WP_000907671.1.69515 WP_000907671.1.6954 WP_000907671.1.69554 WP_000907671.1.69564 WP_000907671.1.69575 WP_000907671.1.69588 WP_000907671.1.69592 WP_000907671.1.69597 WP_000907671.1.69616 WP_000907671.1.69636 WP_000907671.1.69644 WP_000907671.1.69696 WP_000907671.1.69704 WP_000907671.1.69754 WP_000907671.1.69758 WP_000907671.1.69767 WP_000907671.1.69787 WP_000907671.1.69790 WP_000907671.1.69807 WP_000907671.1.69817 WP_000907671.1.69890 WP_000907671.1.69965 WP_000907671.1.69977 WP_000907671.1.69982 WP_000907671.1.70003 WP_000907671.1.70028 WP_000907671.1.70087 WP_000907671.1.70088 WP_000907671.1.7014 WP_000907671.1.7016 WP_000907671.1.70169 WP_000907671.1.70183 WP_000907671.1.7021 WP_000907671.1.70241 WP_000907671.1.70269 WP_000907671.1.70272 WP_000907671.1.70281 WP_000907671.1.70289 WP_000907671.1.70290 WP_000907671.1.70321 WP_000907671.1.70326 WP_000907671.1.70327 WP_000907671.1.70355 WP_000907671.1.7044 WP_000907671.1.70440 WP_000907671.1.70447 WP_000907671.1.70485 WP_000907671.1.70488 WP_000907671.1.70523 WP_000907671.1.70531 WP_000907671.1.7055 WP_000907671.1.70580 WP_000907671.1.70596 WP_000907671.1.70643 WP_000907671.1.70678 WP_000907671.1.70683 WP_000907671.1.70685 WP_000907671.1.70712 WP_000907671.1.70732 WP_000907671.1.70733 WP_000907671.1.70761 WP_000907671.1.70785 WP_000907671.1.70792 WP_000907671.1.70797 WP_000907671.1.70837 WP_000907671.1.70869 WP_000907671.1.70883 WP_000907671.1.70899 WP_000907671.1.70914 WP_000907671.1.70922 WP_000907671.1.7093 WP_000907671.1.70948 WP_000907671.1.70959 WP_000907671.1.70969 WP_000907671.1.70971 WP_000907671.1.70985 WP_000907671.1.70986 WP_000907671.1.71007 WP_000907671.1.71010 WP_000907671.1.71023 WP_000907671.1.71069 WP_000907671.1.71088 WP_000907671.1.7110 WP_000907671.1.71116 WP_000907671.1.71120 WP_000907671.1.71146 WP_000907671.1.71150 WP_000907671.1.71165 WP_000907671.1.71171 WP_000907671.1.71172 WP_000907671.1.71184 WP_000907671.1.71188 WP_000907671.1.71201 WP_000907671.1.71202 WP_000907671.1.71243 WP_000907671.1.71248 WP_000907671.1.71268 WP_000907671.1.71299 WP_000907671.1.71305 WP_000907671.1.71306 WP_000907671.1.71337 WP_000907671.1.71363 WP_000907671.1.71368 WP_000907671.1.71378 WP_000907671.1.714 WP_000907671.1.71401 WP_000907671.1.71407 WP_000907671.1.7142 WP_000907671.1.71446 WP_000907671.1.71450 WP_000907671.1.71481 WP_000907671.1.71500 WP_000907671.1.71583 WP_000907671.1.71626 WP_000907671.1.71636 WP_000907671.1.71649 WP_000907671.1.71702 WP_000907671.1.7174 WP_000907671.1.71746 WP_000907671.1.71750 WP_000907671.1.71756 WP_000907671.1.71798 WP_000907671.1.71845 WP_000907671.1.71881 WP_000907671.1.71908 WP_000907671.1.71929 WP_000907671.1.71941 WP_000907671.1.71952 WP_000907671.1.71973 WP_000907671.1.71979 WP_000907671.1.71984 WP_000907671.1.720 WP_000907671.1.72065 WP_000907671.1.72068 WP_000907671.1.72100 WP_000907671.1.72105 WP_000907671.1.72107 WP_000907671.1.72119 WP_000907671.1.72188 WP_000907671.1.72190 WP_000907671.1.72203 WP_000907671.1.72220 WP_000907671.1.72221 WP_000907671.1.72226 WP_000907671.1.72234 WP_000907671.1.72243 WP_000907671.1.72277 WP_000907671.1.72281 WP_000907671.1.72300 WP_000907671.1.72307 WP_000907671.1.72325 WP_000907671.1.72339 WP_000907671.1.72351 WP_000907671.1.72376 WP_000907671.1.72403 WP_000907671.1.72412 WP_000907671.1.72438 WP_000907671.1.72532 WP_000907671.1.72594 WP_000907671.1.72602 WP_000907671.1.72629 WP_000907671.1.72671 WP_000907671.1.72689 WP_000907671.1.72716 WP_000907671.1.72718 WP_000907671.1.72728 WP_000907671.1.72793 WP_000907671.1.72843 WP_000907671.1.72850 WP_000907671.1.72865 WP_000907671.1.72871 WP_000907671.1.72872 WP_000907671.1.72887 WP_000907671.1.72894 WP_000907671.1.72897 WP_000907671.1.7295 WP_000907671.1.72968 WP_000907671.1.72975 WP_000907671.1.73068 WP_000907671.1.73125 WP_000907671.1.73144 WP_000907671.1.7315 WP_000907671.1.7316 WP_000907671.1.73164 WP_000907671.1.73200 WP_000907671.1.73270 WP_000907671.1.7334 WP_000907671.1.73362 WP_000907671.1.73377 WP_000907671.1.73379 WP_000907671.1.7341 WP_000907671.1.73461 WP_000907671.1.73481 WP_000907671.1.73512 WP_000907671.1.73535 WP_000907671.1.7356 WP_000907671.1.73561 WP_000907671.1.73581 WP_000907671.1.73596 WP_000907671.1.73617 WP_000907671.1.73669 WP_000907671.1.73708 WP_000907671.1.73753 WP_000907671.1.73758 WP_000907671.1.73794 WP_000907671.1.73804 WP_000907671.1.73831 WP_000907671.1.73847 WP_000907671.1.7387 WP_000907671.1.73901 WP_000907671.1.73924 WP_000907671.1.7394 WP_000907671.1.73945 WP_000907671.1.73956 WP_000907671.1.73965 WP_000907671.1.74029 WP_000907671.1.74040 WP_000907671.1.74049 WP_000907671.1.7405 WP_000907671.1.74089 WP_000907671.1.74174 WP_000907671.1.74181 WP_000907671.1.74191 WP_000907671.1.74207 WP_000907671.1.74228 WP_000907671.1.74248 WP_000907671.1.743 WP_000907671.1.74300 WP_000907671.1.7433 WP_000907671.1.74379 WP_000907671.1.74402 WP_000907671.1.74410 WP_000907671.1.74414 WP_000907671.1.74422 WP_000907671.1.74428 WP_000907671.1.7444 WP_000907671.1.74454 WP_000907671.1.74466 WP_000907671.1.74469 WP_000907671.1.74481 WP_000907671.1.745 WP_000907671.1.74500 WP_000907671.1.74529 WP_000907671.1.74545 WP_000907671.1.74578 WP_000907671.1.74632 WP_000907671.1.74639 WP_000907671.1.74644 WP_000907671.1.74702 WP_000907671.1.74745 WP_000907671.1.74757 WP_000907671.1.74806 WP_000907671.1.74807 WP_000907671.1.74826 WP_000907671.1.74876 WP_000907671.1.74884 WP_000907671.1.7491 WP_000907671.1.74996 WP_000907671.1.75051 WP_000907671.1.75056 WP_000907671.1.75058 WP_000907671.1.75129 WP_000907671.1.75134 WP_000907671.1.75148 WP_000907671.1.75159 WP_000907671.1.75168 WP_000907671.1.75177 WP_000907671.1.75180 WP_000907671.1.75187 WP_000907671.1.75288 WP_000907671.1.75301 WP_000907671.1.7531 WP_000907671.1.75334 WP_000907671.1.75362 WP_000907671.1.75385 WP_000907671.1.75392 WP_000907671.1.75400 WP_000907671.1.75402 WP_000907671.1.7543 WP_000907671.1.75450 WP_000907671.1.75494 WP_000907671.1.7558 WP_000907671.1.75585 WP_000907671.1.75607 WP_000907671.1.75626 WP_000907671.1.75664 WP_000907671.1.75703 WP_000907671.1.75716 WP_000907671.1.75740 WP_000907671.1.75751 WP_000907671.1.75760 WP_000907671.1.75764 WP_000907671.1.75810 WP_000907671.1.75828 WP_000907671.1.75863 WP_000907671.1.75873 WP_000907671.1.75874 WP_000907671.1.75884 WP_000907671.1.75902 WP_000907671.1.75932 WP_000907671.1.75945 WP_000907671.1.75957 WP_000907671.1.76020 WP_000907671.1.76024 WP_000907671.1.76097 WP_000907671.1.76102 WP_000907671.1.76108 WP_000907671.1.76137 WP_000907671.1.76156 WP_000907671.1.76170 WP_000907671.1.76186 WP_000907671.1.76208 WP_000907671.1.76252 WP_000907671.1.7629 WP_000907671.1.76327 WP_000907671.1.7633 WP_000907671.1.7634 WP_000907671.1.76345 WP_000907671.1.76346 WP_000907671.1.76364 WP_000907671.1.76434 WP_000907671.1.76445 WP_000907671.1.76451 WP_000907671.1.76471 WP_000907671.1.76495 WP_000907671.1.76529 WP_000907671.1.76532 WP_000907671.1.7655 WP_000907671.1.7657 WP_000907671.1.7660 WP_000907671.1.76611 WP_000907671.1.76673 WP_000907671.1.76706 WP_000907671.1.7672 WP_000907671.1.76721 WP_000907671.1.76724 WP_000907671.1.76738 WP_000907671.1.76756 WP_000907671.1.76760 WP_000907671.1.76776 WP_000907671.1.76799 WP_000907671.1.76806 WP_000907671.1.7684 WP_000907671.1.76866 WP_000907671.1.76875 WP_000907671.1.76880 WP_000907671.1.76899 WP_000907671.1.76913 WP_000907671.1.76968 WP_000907671.1.77017 WP_000907671.1.77033 WP_000907671.1.77038 WP_000907671.1.77047 WP_000907671.1.77080 WP_000907671.1.7712 WP_000907671.1.77177 WP_000907671.1.77180 WP_000907671.1.77184 WP_000907671.1.77193 WP_000907671.1.77241 WP_000907671.1.77244 WP_000907671.1.77267 WP_000907671.1.77292 WP_000907671.1.77306 WP_000907671.1.77313 WP_000907671.1.77349 WP_000907671.1.77356 WP_000907671.1.77414 WP_000907671.1.77436 WP_000907671.1.77475 WP_000907671.1.77496 WP_000907671.1.77514 WP_000907671.1.77529 WP_000907671.1.77543 WP_000907671.1.77549 WP_000907671.1.77555 WP_000907671.1.77565 WP_000907671.1.77575 WP_000907671.1.77596 WP_000907671.1.77646 WP_000907671.1.77653 WP_000907671.1.77692 WP_000907671.1.77710 WP_000907671.1.77729 WP_000907671.1.77754 WP_000907671.1.77761 WP_000907671.1.7782 WP_000907671.1.77846 WP_000907671.1.77851 WP_000907671.1.77871 WP_000907671.1.77898 WP_000907671.1.77918 WP_000907671.1.7792 WP_000907671.1.7793 WP_000907671.1.77951 WP_000907671.1.77960 WP_000907671.1.77971 WP_000907671.1.77983 WP_000907671.1.77989 WP_000907671.1.78 WP_000907671.1.78016 WP_000907671.1.7802 WP_000907671.1.78026 WP_000907671.1.78033 WP_000907671.1.78051 WP_000907671.1.78053 WP_000907671.1.78076 WP_000907671.1.78096 WP_000907671.1.78100 WP_000907671.1.78110 WP_000907671.1.78120 WP_000907671.1.7814 WP_000907671.1.78170 WP_000907671.1.78180 WP_000907671.1.78201 WP_000907671.1.78339 WP_000907671.1.78366 WP_000907671.1.78372 WP_000907671.1.78383 WP_000907671.1.78407 WP_000907671.1.78495 WP_000907671.1.78496 WP_000907671.1.78501 WP_000907671.1.78502 WP_000907671.1.78602 WP_000907671.1.78603 WP_000907671.1.7861 WP_000907671.1.78618 WP_000907671.1.78632 WP_000907671.1.78658 WP_000907671.1.78673 WP_000907671.1.78697 WP_000907671.1.78715 WP_000907671.1.78734 WP_000907671.1.78735 WP_000907671.1.7877 WP_000907671.1.78771 WP_000907671.1.78789 WP_000907671.1.78802 WP_000907671.1.78815 WP_000907671.1.78830 WP_000907671.1.78835 WP_000907671.1.78838 WP_000907671.1.78862 WP_000907671.1.78871 WP_000907671.1.78874 WP_000907671.1.78877 WP_000907671.1.78881 WP_000907671.1.7891 WP_000907671.1.78913 WP_000907671.1.78918 WP_000907671.1.7893 WP_000907671.1.78930 WP_000907671.1.78951 WP_000907671.1.79011 WP_000907671.1.79099 WP_000907671.1.79140 WP_000907671.1.79151 WP_000907671.1.79167 WP_000907671.1.79189 WP_000907671.1.79203 WP_000907671.1.79235 WP_000907671.1.79289 WP_000907671.1.79297 WP_000907671.1.79335 WP_000907671.1.79370 WP_000907671.1.794 WP_000907671.1.79427 WP_000907671.1.79462 WP_000907671.1.79466 WP_000907671.1.79468 WP_000907671.1.79472 WP_000907671.1.79490 WP_000907671.1.79529 WP_000907671.1.7956 WP_000907671.1.79570 WP_000907671.1.79580 WP_000907671.1.79586 WP_000907671.1.79635 WP_000907671.1.7964 WP_000907671.1.79642 WP_000907671.1.79659 WP_000907671.1.79668 WP_000907671.1.79708 WP_000907671.1.7972 WP_000907671.1.79734 WP_000907671.1.79738 WP_000907671.1.79778 WP_000907671.1.7979 WP_000907671.1.7982 WP_000907671.1.79832 WP_000907671.1.79845 WP_000907671.1.79867 WP_000907671.1.79892 WP_000907671.1.7991 WP_000907671.1.79910 WP_000907671.1.79914 WP_000907671.1.79929 WP_000907671.1.79934 WP_000907671.1.7994 WP_000907671.1.79942 WP_000907671.1.79951 WP_000907671.1.79974 WP_000907671.1.80077 WP_000907671.1.80137 WP_000907671.1.80149 WP_000907671.1.80182 WP_000907671.1.80229 WP_000907671.1.8024 WP_000907671.1.80249 WP_000907671.1.80254 WP_000907671.1.80293 WP_000907671.1.80296 WP_000907671.1.80307 WP_000907671.1.80333 WP_000907671.1.80366 WP_000907671.1.80380 WP_000907671.1.80441 WP_000907671.1.80443 WP_000907671.1.80448 WP_000907671.1.80473 WP_000907671.1.80479 WP_000907671.1.80480 WP_000907671.1.80496 WP_000907671.1.80529 WP_000907671.1.80542 WP_000907671.1.80586 WP_000907671.1.80629 WP_000907671.1.80707 WP_000907671.1.80723 WP_000907671.1.80725 WP_000907671.1.80741 WP_000907671.1.80757 WP_000907671.1.80760 WP_000907671.1.80780 WP_000907671.1.80803 WP_000907671.1.80827 WP_000907671.1.80831 WP_000907671.1.80840 WP_000907671.1.80850 WP_000907671.1.80857 WP_000907671.1.80868 WP_000907671.1.80874 WP_000907671.1.80876 WP_000907671.1.80881 WP_000907671.1.80939 WP_000907671.1.8096 WP_000907671.1.81037 WP_000907671.1.81062 WP_000907671.1.81069 WP_000907671.1.81107 WP_000907671.1.81109 WP_000907671.1.81110 WP_000907671.1.81118 WP_000907671.1.81149 WP_000907671.1.81175 WP_000907671.1.8119 WP_000907671.1.81193 WP_000907671.1.81197 WP_000907671.1.81225 WP_000907671.1.8127 WP_000907671.1.81275 WP_000907671.1.8130 WP_000907671.1.81302 WP_000907671.1.81305 WP_000907671.1.81320 WP_000907671.1.81328 WP_000907671.1.8134 WP_000907671.1.81354 WP_000907671.1.81388 WP_000907671.1.81404 WP_000907671.1.81425 WP_000907671.1.81472 WP_000907671.1.81528 WP_000907671.1.81668 WP_000907671.1.81727 WP_000907671.1.81735 WP_000907671.1.81736 WP_000907671.1.81743 WP_000907671.1.81750 WP_000907671.1.81760 WP_000907671.1.81768 WP_000907671.1.81785 WP_000907671.1.81795 WP_000907671.1.81902 WP_000907671.1.81941 WP_000907671.1.8196 WP_000907671.1.81965 WP_000907671.1.81974 WP_000907671.1.82037 WP_000907671.1.82099 WP_000907671.1.82144 WP_000907671.1.82149 WP_000907671.1.82192 WP_000907671.1.82232 WP_000907671.1.82337 WP_000907671.1.82352 WP_000907671.1.82395 WP_000907671.1.82401 WP_000907671.1.82420 WP_000907671.1.82434 WP_000907671.1.82464 WP_000907671.1.8247 WP_000907671.1.82474 WP_000907671.1.82479 WP_000907671.1.82503 WP_000907671.1.82515 WP_000907671.1.82529 WP_000907671.1.82530 WP_000907671.1.82562 WP_000907671.1.82569 WP_000907671.1.82570 WP_000907671.1.82584 WP_000907671.1.82637 WP_000907671.1.82648 WP_000907671.1.82676 WP_000907671.1.82761 WP_000907671.1.8282 WP_000907671.1.82841 WP_000907671.1.82843 WP_000907671.1.82867 WP_000907671.1.82886 WP_000907671.1.82895 WP_000907671.1.82899 WP_000907671.1.82908 WP_000907671.1.82937 WP_000907671.1.82944 WP_000907671.1.82956 WP_000907671.1.82964 WP_000907671.1.82992 WP_000907671.1.83005 WP_000907671.1.83006 WP_000907671.1.83061 WP_000907671.1.83092 WP_000907671.1.83128 WP_000907671.1.83139 WP_000907671.1.83163 WP_000907671.1.83204 WP_000907671.1.83247 WP_000907671.1.83258 WP_000907671.1.83301 WP_000907671.1.83331 WP_000907671.1.83354 WP_000907671.1.83356 WP_000907671.1.83360 WP_000907671.1.83382 WP_000907671.1.83388 WP_000907671.1.83407 WP_000907671.1.83413 WP_000907671.1.83491 WP_000907671.1.83510 WP_000907671.1.83516 WP_000907671.1.83523 WP_000907671.1.8354 WP_000907671.1.83558 WP_000907671.1.83572 WP_000907671.1.83598 WP_000907671.1.83650 WP_000907671.1.83651 WP_000907671.1.83710 WP_000907671.1.83721 WP_000907671.1.83739 WP_000907671.1.83759 WP_000907671.1.83760 WP_000907671.1.83854 WP_000907671.1.83979 WP_000907671.1.8399 WP_000907671.1.83995 WP_000907671.1.84000 WP_000907671.1.84001 WP_000907671.1.84011 WP_000907671.1.84031 WP_000907671.1.84075 WP_000907671.1.84077 WP_000907671.1.84083 WP_000907671.1.84086 WP_000907671.1.84100 WP_000907671.1.84103 WP_000907671.1.84115 WP_000907671.1.84154 WP_000907671.1.84179 WP_000907671.1.84198 WP_000907671.1.84205 WP_000907671.1.84209 WP_000907671.1.84229 WP_000907671.1.84283 WP_000907671.1.84291 WP_000907671.1.84300 WP_000907671.1.84325 WP_000907671.1.84355 WP_000907671.1.84359 WP_000907671.1.84373 WP_000907671.1.84392 WP_000907671.1.84397 WP_000907671.1.84403 WP_000907671.1.8441 WP_000907671.1.84459 WP_000907671.1.84475 WP_000907671.1.84497 WP_000907671.1.84515 WP_000907671.1.84523 WP_000907671.1.84532 WP_000907671.1.84551 WP_000907671.1.84554 WP_000907671.1.84572 WP_000907671.1.84598 WP_000907671.1.84644 WP_000907671.1.84659 WP_000907671.1.84711 WP_000907671.1.84721 WP_000907671.1.84745 WP_000907671.1.84876 WP_000907671.1.84899 WP_000907671.1.8497 WP_000907671.1.84983 WP_000907671.1.850 WP_000907671.1.85014 WP_000907671.1.85031 WP_000907671.1.85040 WP_000907671.1.85079 WP_000907671.1.85120 WP_000907671.1.85126 WP_000907671.1.85134 WP_000907671.1.85147 WP_000907671.1.85178 WP_000907671.1.85180 WP_000907671.1.85190 WP_000907671.1.85192 WP_000907671.1.85217 WP_000907671.1.8526 WP_000907671.1.85271 WP_000907671.1.85301 WP_000907671.1.8533 WP_000907671.1.8537 WP_000907671.1.85408 WP_000907671.1.85456 WP_000907671.1.85469 WP_000907671.1.85481 WP_000907671.1.85483 WP_000907671.1.8552 WP_000907671.1.85541 WP_000907671.1.8556 WP_000907671.1.85568 WP_000907671.1.85615 WP_000907671.1.85617 WP_000907671.1.85654 WP_000907671.1.85663 WP_000907671.1.85671 WP_000907671.1.85672 WP_000907671.1.85723 WP_000907671.1.85742 WP_000907671.1.85759 WP_000907671.1.85777 WP_000907671.1.85780 WP_000907671.1.85784 WP_000907671.1.85797 WP_000907671.1.85864 WP_000907671.1.85886 WP_000907671.1.85900 WP_000907671.1.85904 WP_000907671.1.8591 WP_000907671.1.85943 WP_000907671.1.85976 WP_000907671.1.86010 WP_000907671.1.86017 WP_000907671.1.86043 WP_000907671.1.86092 WP_000907671.1.86120 WP_000907671.1.86126 WP_000907671.1.86138 WP_000907671.1.86157 WP_000907671.1.8616 WP_000907671.1.86173 WP_000907671.1.86206 WP_000907671.1.86224 WP_000907671.1.86259 WP_000907671.1.86284 WP_000907671.1.86285 WP_000907671.1.86306 WP_000907671.1.86310 WP_000907671.1.86316 WP_000907671.1.86347 WP_000907671.1.86356 WP_000907671.1.86380 WP_000907671.1.86389 WP_000907671.1.86442 WP_000907671.1.86450 WP_000907671.1.86453 WP_000907671.1.86469 WP_000907671.1.86514 WP_000907671.1.86580 WP_000907671.1.86588 WP_000907671.1.86593 WP_000907671.1.86610 WP_000907671.1.86634 WP_000907671.1.86656 WP_000907671.1.86658 WP_000907671.1.86661 WP_000907671.1.86676 WP_000907671.1.8671 WP_000907671.1.8672 WP_000907671.1.86735 WP_000907671.1.8678 WP_000907671.1.86807 WP_000907671.1.86810 WP_000907671.1.8684 WP_000907671.1.86859 WP_000907671.1.86860 WP_000907671.1.86895 WP_000907671.1.86906 WP_000907671.1.8691 WP_000907671.1.86915 WP_000907671.1.86921 WP_000907671.1.86982 WP_000907671.1.87038 WP_000907671.1.87051 WP_000907671.1.87095 WP_000907671.1.87143 WP_000907671.1.87148 WP_000907671.1.87187 WP_000907671.1.87219 WP_000907671.1.8722 WP_000907671.1.87265 WP_000907671.1.87282 WP_000907671.1.87283 WP_000907671.1.87323 WP_000907671.1.87346 WP_000907671.1.8736 WP_000907671.1.87365 WP_000907671.1.87370 WP_000907671.1.87460 WP_000907671.1.87484 WP_000907671.1.87493 WP_000907671.1.87552 WP_000907671.1.87583 WP_000907671.1.87618 WP_000907671.1.87626 WP_000907671.1.87687 WP_000907671.1.87695 WP_000907671.1.87712 WP_000907671.1.87779 WP_000907671.1.87813 WP_000907671.1.87875 WP_000907671.1.87899 WP_000907671.1.87905 WP_000907671.1.8792 WP_000907671.1.87933 WP_000907671.1.87945 WP_000907671.1.87999 WP_000907671.1.8800 WP_000907671.1.88019 WP_000907671.1.88052 WP_000907671.1.88073 WP_000907671.1.8809 WP_000907671.1.88092 WP_000907671.1.88136 WP_000907671.1.88165 WP_000907671.1.88185 WP_000907671.1.88214 WP_000907671.1.88244 WP_000907671.1.88275 WP_000907671.1.88291 WP_000907671.1.88293 WP_000907671.1.88303 WP_000907671.1.88356 WP_000907671.1.8837 WP_000907671.1.88393 WP_000907671.1.88474 WP_000907671.1.88483 WP_000907671.1.8849 WP_000907671.1.88508 WP_000907671.1.88597 WP_000907671.1.88609 WP_000907671.1.88624 WP_000907671.1.88675 WP_000907671.1.88683 WP_000907671.1.88698 WP_000907671.1.88703 WP_000907671.1.88731 WP_000907671.1.88762 WP_000907671.1.88776 WP_000907671.1.88792 WP_000907671.1.88845 WP_000907671.1.88854 WP_000907671.1.88902 WP_000907671.1.8891 WP_000907671.1.88942 WP_000907671.1.88957 WP_000907671.1.88966 WP_000907671.1.88967 WP_000907671.1.88968 WP_000907671.1.88970 WP_000907671.1.88980 WP_000907671.1.88981 WP_000907671.1.88998 WP_000907671.1.89008 WP_000907671.1.89114 WP_000907671.1.89116 WP_000907671.1.89119 WP_000907671.1.89120 WP_000907671.1.89138 WP_000907671.1.89177 WP_000907671.1.89221 WP_000907671.1.89354 WP_000907671.1.89362 WP_000907671.1.89408 WP_000907671.1.89425 WP_000907671.1.89462 WP_000907671.1.89512 WP_000907671.1.89527 WP_000907671.1.89570 WP_000907671.1.8958 WP_000907671.1.89580 WP_000907671.1.89604 WP_000907671.1.89606 WP_000907671.1.8961 WP_000907671.1.89622 WP_000907671.1.89632 WP_000907671.1.89657 WP_000907671.1.89659 WP_000907671.1.89680 WP_000907671.1.89746 WP_000907671.1.89765 WP_000907671.1.89789 WP_000907671.1.89815 WP_000907671.1.89817 WP_000907671.1.89832 WP_000907671.1.89870 WP_000907671.1.89902 WP_000907671.1.89914 WP_000907671.1.89940 WP_000907671.1.8996 WP_000907671.1.89975 WP_000907671.1.9002 WP_000907671.1.9003 WP_000907671.1.90084 WP_000907671.1.90097 WP_000907671.1.90193 WP_000907671.1.90211 WP_000907671.1.90248 WP_000907671.1.90252 WP_000907671.1.90293 WP_000907671.1.90311 WP_000907671.1.90348 WP_000907671.1.90363 WP_000907671.1.90409 WP_000907671.1.90417 WP_000907671.1.90421 WP_000907671.1.90440 WP_000907671.1.90453 WP_000907671.1.90458 WP_000907671.1.90472 WP_000907671.1.90521 WP_000907671.1.90522 WP_000907671.1.90540 WP_000907671.1.90557 WP_000907671.1.90563 WP_000907671.1.90585 WP_000907671.1.90620 WP_000907671.1.9064 WP_000907671.1.90641 WP_000907671.1.90686 WP_000907671.1.90701 WP_000907671.1.90734 WP_000907671.1.90748 WP_000907671.1.90759 WP_000907671.1.90814 WP_000907671.1.90866 WP_000907671.1.90878 WP_000907671.1.9089 WP_000907671.1.9093 WP_000907671.1.90959 WP_000907671.1.90973 WP_000907671.1.90991 WP_000907671.1.91003 WP_000907671.1.91023 WP_000907671.1.91042 WP_000907671.1.91049 WP_000907671.1.91056 WP_000907671.1.91069 WP_000907671.1.91107 WP_000907671.1.91156 WP_000907671.1.91179 WP_000907671.1.91189 WP_000907671.1.91215 WP_000907671.1.91278 WP_000907671.1.91334 WP_000907671.1.9137 WP_000907671.1.91372 WP_000907671.1.91381 WP_000907671.1.91424 WP_000907671.1.91453 WP_000907671.1.91470 WP_000907671.1.91473 WP_000907671.1.91474 WP_000907671.1.91493 WP_000907671.1.91505 WP_000907671.1.91512 WP_000907671.1.91524 WP_000907671.1.91528 WP_000907671.1.91564 WP_000907671.1.91579 WP_000907671.1.91621 WP_000907671.1.91628 WP_000907671.1.91655 WP_000907671.1.91724 WP_000907671.1.91732 WP_000907671.1.91736 WP_000907671.1.91742 WP_000907671.1.91772 WP_000907671.1.91776 WP_000907671.1.91788 WP_000907671.1.91795 WP_000907671.1.91806 WP_000907671.1.91864 WP_000907671.1.91880 WP_000907671.1.91898 WP_000907671.1.91903 WP_000907671.1.91904 WP_000907671.1.91914 WP_000907671.1.91974 WP_000907671.1.92013 WP_000907671.1.92044 WP_000907671.1.92047 WP_000907671.1.92067 WP_000907671.1.92068 WP_000907671.1.92082 WP_000907671.1.92093 WP_000907671.1.92099 WP_000907671.1.92108 WP_000907671.1.92122 WP_000907671.1.92129 WP_000907671.1.92149 WP_000907671.1.92165 WP_000907671.1.92183 WP_000907671.1.92208 WP_000907671.1.9222 WP_000907671.1.92268 WP_000907671.1.92270 WP_000907671.1.92299 WP_000907671.1.92310 WP_000907671.1.92318 WP_000907671.1.92375 WP_000907671.1.92394 WP_000907671.1.92399 WP_000907671.1.92408 WP_000907671.1.92439 WP_000907671.1.92443 WP_000907671.1.92452 WP_000907671.1.92482 WP_000907671.1.92529 WP_000907671.1.9253 WP_000907671.1.92531 WP_000907671.1.92557 WP_000907671.1.92562 WP_000907671.1.92628 WP_000907671.1.92669 WP_000907671.1.92671 WP_000907671.1.92729 WP_000907671.1.92738 WP_000907671.1.92758 WP_000907671.1.92806 WP_000907671.1.92827 WP_000907671.1.92832 WP_000907671.1.92836 WP_000907671.1.92843 WP_000907671.1.92875 WP_000907671.1.92883 WP_000907671.1.92890 WP_000907671.1.92893 WP_000907671.1.92895 WP_000907671.1.92926 WP_000907671.1.92929 WP_000907671.1.92939 WP_000907671.1.92975 WP_000907671.1.92988 WP_000907671.1.93059 WP_000907671.1.93061 WP_000907671.1.93076 WP_000907671.1.93086 WP_000907671.1.93101 WP_000907671.1.93136 WP_000907671.1.93155 WP_000907671.1.93213 WP_000907671.1.93215 WP_000907671.1.93322 WP_000907671.1.93339 WP_000907671.1.93365 WP_000907671.1.93524 WP_000907671.1.93543 WP_000907671.1.93577 WP_000907671.1.93596 WP_000907671.1.93648 WP_000907671.1.93650 WP_000907671.1.93656 WP_000907671.1.93662 WP_000907671.1.93671 WP_000907671.1.93691 WP_000907671.1.937 WP_000907671.1.93705 WP_000907671.1.93741 WP_000907671.1.93761 WP_000907671.1.93767 WP_000907671.1.9380 WP_000907671.1.93803 WP_000907671.1.93804 WP_000907671.1.93809 WP_000907671.1.9389 WP_000907671.1.93937 WP_000907671.1.93956 WP_000907671.1.93986 WP_000907671.1.93994 WP_000907671.1.94039 WP_000907671.1.94056 WP_000907671.1.94064 WP_000907671.1.94072 WP_000907671.1.94132 WP_000907671.1.94162 WP_000907671.1.94168 WP_000907671.1.94181 WP_000907671.1.94198 WP_000907671.1.9432 WP_000907671.1.94354 WP_000907671.1.94379 WP_000907671.1.94380 WP_000907671.1.9440 WP_000907671.1.94412 WP_000907671.1.94458 WP_000907671.1.94557 WP_000907671.1.94562 WP_000907671.1.94565 WP_000907671.1.94584 WP_000907671.1.94588 WP_000907671.1.94598 WP_000907671.1.94622 WP_000907671.1.9463 WP_000907671.1.94649 WP_000907671.1.94655 WP_000907671.1.94669 WP_000907671.1.94670 WP_000907671.1.94674 WP_000907671.1.94717 WP_000907671.1.94785 WP_000907671.1.94796 WP_000907671.1.9481 WP_000907671.1.94817 WP_000907671.1.94835 WP_000907671.1.94849 WP_000907671.1.94862 WP_000907671.1.94947 WP_000907671.1.94959 WP_000907671.1.94967 WP_000907671.1.94971 WP_000907671.1.94982 WP_000907671.1.94986 WP_000907671.1.94987 WP_000907671.1.9503 WP_000907671.1.95051 WP_000907671.1.95085 WP_000907671.1.95121 WP_000907671.1.95136 WP_000907671.1.9516 WP_000907671.1.95171 WP_000907671.1.95235 WP_000907671.1.95248 WP_000907671.1.95249 WP_000907671.1.9527 WP_000907671.1.95277 WP_000907671.1.95282 WP_000907671.1.95289 WP_000907671.1.95298 WP_000907671.1.9530 WP_000907671.1.95388 WP_000907671.1.95434 WP_000907671.1.95447 WP_000907671.1.95456 WP_000907671.1.95465 WP_000907671.1.95546 WP_000907671.1.95579 WP_000907671.1.95607 WP_000907671.1.95623 WP_000907671.1.95630 WP_000907671.1.95641 WP_000907671.1.95656 WP_000907671.1.95670 WP_000907671.1.95691 WP_000907671.1.95703 WP_000907671.1.95729 WP_000907671.1.9574 WP_000907671.1.95744 WP_000907671.1.95757 WP_000907671.1.95803 WP_000907671.1.95840 WP_000907671.1.9586 WP_000907671.1.95866 WP_000907671.1.95901 WP_000907671.1.95911 WP_000907671.1.95939 WP_000907671.1.95940 WP_000907671.1.95963 WP_000907671.1.96004 WP_000907671.1.96042 WP_000907671.1.96045 WP_000907671.1.9609 WP_000907671.1.96107 WP_000907671.1.96139 WP_000907671.1.96141 WP_000907671.1.96162 WP_000907671.1.96172 WP_000907671.1.96190 WP_000907671.1.96206 WP_000907671.1.9624 WP_000907671.1.96260 WP_000907671.1.9627 WP_000907671.1.96317 WP_000907671.1.96335 WP_000907671.1.96340 WP_000907671.1.96343 WP_000907671.1.96348 WP_000907671.1.96349 WP_000907671.1.96380 WP_000907671.1.96404 WP_000907671.1.9644 WP_000907671.1.96469 WP_000907671.1.96497 WP_000907671.1.96500 WP_000907671.1.96521 WP_000907671.1.96533 WP_000907671.1.96537 WP_000907671.1.96555 WP_000907671.1.96563 WP_000907671.1.96590 WP_000907671.1.96600 WP_000907671.1.96642 WP_000907671.1.96721 WP_000907671.1.96732 WP_000907671.1.96735 WP_000907671.1.9674 WP_000907671.1.96758 WP_000907671.1.96761 WP_000907671.1.96771 WP_000907671.1.96798 WP_000907671.1.96810 WP_000907671.1.9686 WP_000907671.1.96876 WP_000907671.1.96902 WP_000907671.1.96917 WP_000907671.1.96993 WP_000907671.1.97005 WP_000907671.1.97015 WP_000907671.1.97047 WP_000907671.1.97103 WP_000907671.1.97143 WP_000907671.1.97145 WP_000907671.1.97190 WP_000907671.1.97224 WP_000907671.1.97260 WP_000907671.1.97297 WP_000907671.1.97318 WP_000907671.1.97322 WP_000907671.1.97328 WP_000907671.1.97337 WP_000907671.1.97368 WP_000907671.1.97369 WP_000907671.1.97477 WP_000907671.1.97480 WP_000907671.1.97487 WP_000907671.1.97496 WP_000907671.1.97534 WP_000907671.1.97547 WP_000907671.1.97594 WP_000907671.1.97597 WP_000907671.1.97613 WP_000907671.1.97620 WP_000907671.1.97631 WP_000907671.1.97640 WP_000907671.1.97648 WP_000907671.1.97656 WP_000907671.1.97704 WP_000907671.1.97725 WP_000907671.1.97726 WP_000907671.1.97727 WP_000907671.1.97732 WP_000907671.1.97736 WP_000907671.1.9774 WP_000907671.1.9775 WP_000907671.1.97772 WP_000907671.1.97800 WP_000907671.1.97846 WP_000907671.1.97873 WP_000907671.1.97907 WP_000907671.1.9793 WP_000907671.1.97981 WP_000907671.1.97983 WP_000907671.1.9799 WP_000907671.1.97991 WP_000907671.1.98006 WP_000907671.1.98019 WP_000907671.1.98022 WP_000907671.1.9805 WP_000907671.1.9811 WP_000907671.1.98110 WP_000907671.1.98119 WP_000907671.1.98124 WP_000907671.1.98146 WP_000907671.1.98170 WP_000907671.1.98201 WP_000907671.1.98219 WP_000907671.1.98236 WP_000907671.1.9826 WP_000907671.1.98314 WP_000907671.1.98338 WP_000907671.1.98402 WP_000907671.1.98403 WP_000907671.1.9841 WP_000907671.1.98438 WP_000907671.1.98440 WP_000907671.1.98446 WP_000907671.1.98472 WP_000907671.1.98483 WP_000907671.1.98495 WP_000907671.1.98513 WP_000907671.1.98531 WP_000907671.1.98570 WP_000907671.1.98577 WP_000907671.1.98608 WP_000907671.1.98627 WP_000907671.1.9863 WP_000907671.1.98677 WP_000907671.1.98726 WP_000907671.1.98751 WP_000907671.1.98760 WP_000907671.1.98763 WP_000907671.1.98779 WP_000907671.1.98843 WP_000907671.1.9887 WP_000907671.1.98899 WP_000907671.1.98931 WP_000907671.1.9898 WP_000907671.1.9899 WP_000907671.1.99057 WP_000907671.1.99071 WP_000907671.1.99072 WP_000907671.1.99083 WP_000907671.1.99097 WP_000907671.1.99098 WP_000907671.1.99107 WP_000907671.1.99164 WP_000907671.1.99184 WP_000907671.1.9919 WP_000907671.1.99198 WP_000907671.1.99215 WP_000907671.1.99267 WP_000907671.1.99276 WP_000907671.1.99278 WP_000907671.1.99370 WP_000907671.1.99456 WP_000907671.1.99469 WP_000907671.1.99490 WP_000907671.1.99493 WP_000907671.1.9954 WP_000907671.1.99561 WP_000907671.1.99613 WP_000907671.1.99626 WP_000907671.1.99630 WP_000907671.1.99637 WP_000907671.1.99646 WP_000907671.1.99657 WP_000907671.1.99660 WP_000907671.1.99712 WP_000907671.1.99725 WP_000907671.1.99783 WP_000907671.1.99813 WP_000907671.1.99824 WP_000907671.1.99858 WP_000907671.1.99889 WP_000907671.1.99924 WP_000907671.1.99958 WP_000907671.1.99961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]