SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410023174|ref|YP_005237044.2| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410023174|ref|YP_005237044.2|
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Phage tail proteins 4.25e-53
Family gpFII-like 0.0000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410023174|ref|YP_005237044.2|
Sequence length 127
Comment minor capsid protein FII [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSQSENLFDTAISQADDAILRVMGTVATITSGVLAGATLTGVFDDPESVSYAAGGVRIEG
DKPTFFVKTSLTVHLKRPDTLTILGDTFWVDRITPAGGDSSIILLGRGTPPTDNRRRTGG
MFDCSPA
Download sequence
Identical sequences A0A0F6B524 A0A0H3BRN2 A0A0H3NKL1 A0A0R9Q870 A0A158MT04 A0A2C6X5X4 A0A2H9Y9V9 A0A2J0RBG4 E8XHI3 Q8ZN00
gi|409248363|ref|YP_006889048.1| gi|378446020|ref|YP_005233652.1| gi|194443993|ref|YP_002041865.1| NP_461537.1.58477 WP_000083294.1.100376 WP_000083294.1.100436 WP_000083294.1.100484 WP_000083294.1.100488 WP_000083294.1.100502 WP_000083294.1.100597 WP_000083294.1.100711 WP_000083294.1.10076 WP_000083294.1.100871 WP_000083294.1.101078 WP_000083294.1.101185 WP_000083294.1.101404 WP_000083294.1.101734 WP_000083294.1.10266 WP_000083294.1.10429 WP_000083294.1.106 WP_000083294.1.10675 WP_000083294.1.10992 WP_000083294.1.11024 WP_000083294.1.11098 WP_000083294.1.11168 WP_000083294.1.11295 WP_000083294.1.11455 WP_000083294.1.11458 WP_000083294.1.11518 WP_000083294.1.11543 WP_000083294.1.11897 WP_000083294.1.12370 WP_000083294.1.1246 WP_000083294.1.12718 WP_000083294.1.12728 WP_000083294.1.13106 WP_000083294.1.1326 WP_000083294.1.13414 WP_000083294.1.13488 WP_000083294.1.13509 WP_000083294.1.13669 WP_000083294.1.13741 WP_000083294.1.1387 WP_000083294.1.13932 WP_000083294.1.14239 WP_000083294.1.14379 WP_000083294.1.14466 WP_000083294.1.14554 WP_000083294.1.14852 WP_000083294.1.14876 WP_000083294.1.1489 WP_000083294.1.15046 WP_000083294.1.15079 WP_000083294.1.15124 WP_000083294.1.15226 WP_000083294.1.15483 WP_000083294.1.15508 WP_000083294.1.15625 WP_000083294.1.15708 WP_000083294.1.158 WP_000083294.1.15909 WP_000083294.1.16062 WP_000083294.1.16103 WP_000083294.1.1635 WP_000083294.1.16691 WP_000083294.1.16786 WP_000083294.1.16896 WP_000083294.1.16916 WP_000083294.1.16941 WP_000083294.1.17285 WP_000083294.1.17307 WP_000083294.1.17480 WP_000083294.1.17546 WP_000083294.1.17705 WP_000083294.1.17991 WP_000083294.1.18267 WP_000083294.1.18468 WP_000083294.1.18776 WP_000083294.1.18940 WP_000083294.1.18949 WP_000083294.1.1897 WP_000083294.1.19320 WP_000083294.1.19460 WP_000083294.1.19702 WP_000083294.1.19706 WP_000083294.1.19749 WP_000083294.1.19802 WP_000083294.1.1998 WP_000083294.1.20 WP_000083294.1.2010 WP_000083294.1.20212 WP_000083294.1.20391 WP_000083294.1.20418 WP_000083294.1.20425 WP_000083294.1.20525 WP_000083294.1.20695 WP_000083294.1.20787 WP_000083294.1.20908 WP_000083294.1.21362 WP_000083294.1.21603 WP_000083294.1.21757 WP_000083294.1.2221 WP_000083294.1.2235 WP_000083294.1.22427 WP_000083294.1.22870 WP_000083294.1.23155 WP_000083294.1.23472 WP_000083294.1.23482 WP_000083294.1.23646 WP_000083294.1.23736 WP_000083294.1.23932 WP_000083294.1.24017 WP_000083294.1.24206 WP_000083294.1.24259 WP_000083294.1.24779 WP_000083294.1.25015 WP_000083294.1.25454 WP_000083294.1.25668 WP_000083294.1.25740 WP_000083294.1.25988 WP_000083294.1.26282 WP_000083294.1.26319 WP_000083294.1.26363 WP_000083294.1.26426 WP_000083294.1.26440 WP_000083294.1.26551 WP_000083294.1.26582 WP_000083294.1.26882 WP_000083294.1.27010 WP_000083294.1.27173 WP_000083294.1.27206 WP_000083294.1.27423 WP_000083294.1.27561 WP_000083294.1.2763 WP_000083294.1.27707 WP_000083294.1.27761 WP_000083294.1.28094 WP_000083294.1.28612 WP_000083294.1.28625 WP_000083294.1.28938 WP_000083294.1.29006 WP_000083294.1.29010 WP_000083294.1.29601 WP_000083294.1.29619 WP_000083294.1.29969 WP_000083294.1.30027 WP_000083294.1.30909 WP_000083294.1.30972 WP_000083294.1.3119 WP_000083294.1.31195 WP_000083294.1.31210 WP_000083294.1.31476 WP_000083294.1.31504 WP_000083294.1.31578 WP_000083294.1.31972 WP_000083294.1.32204 WP_000083294.1.32438 WP_000083294.1.32515 WP_000083294.1.32702 WP_000083294.1.32907 WP_000083294.1.33106 WP_000083294.1.33248 WP_000083294.1.33261 WP_000083294.1.33392 WP_000083294.1.33553 WP_000083294.1.34043 WP_000083294.1.34279 WP_000083294.1.34319 WP_000083294.1.34610 WP_000083294.1.34856 WP_000083294.1.34975 WP_000083294.1.35184 WP_000083294.1.35408 WP_000083294.1.35446 WP_000083294.1.35463 WP_000083294.1.35503 WP_000083294.1.36157 WP_000083294.1.3670 WP_000083294.1.36765 WP_000083294.1.37111 WP_000083294.1.37112 WP_000083294.1.37504 WP_000083294.1.37558 WP_000083294.1.37978 WP_000083294.1.38145 WP_000083294.1.38199 WP_000083294.1.3848 WP_000083294.1.38913 WP_000083294.1.39082 WP_000083294.1.39385 WP_000083294.1.39420 WP_000083294.1.39553 WP_000083294.1.39576 WP_000083294.1.39609 WP_000083294.1.39921 WP_000083294.1.39923 WP_000083294.1.4011 WP_000083294.1.40240 WP_000083294.1.40257 WP_000083294.1.40292 WP_000083294.1.40380 WP_000083294.1.40465 WP_000083294.1.4087 WP_000083294.1.41017 WP_000083294.1.41554 WP_000083294.1.41572 WP_000083294.1.41591 WP_000083294.1.41662 WP_000083294.1.41979 WP_000083294.1.42248 WP_000083294.1.42605 WP_000083294.1.4276 WP_000083294.1.42797 WP_000083294.1.42829 WP_000083294.1.42864 WP_000083294.1.4288 WP_000083294.1.42887 WP_000083294.1.42923 WP_000083294.1.43244 WP_000083294.1.43312 WP_000083294.1.43334 WP_000083294.1.43522 WP_000083294.1.43613 WP_000083294.1.43875 WP_000083294.1.44005 WP_000083294.1.4405 WP_000083294.1.44063 WP_000083294.1.44099 WP_000083294.1.4423 WP_000083294.1.44386 WP_000083294.1.44440 WP_000083294.1.44443 WP_000083294.1.44640 WP_000083294.1.4467 WP_000083294.1.44678 WP_000083294.1.44833 WP_000083294.1.45067 WP_000083294.1.45074 WP_000083294.1.45184 WP_000083294.1.45550 WP_000083294.1.45585 WP_000083294.1.46112 WP_000083294.1.46187 WP_000083294.1.46205 WP_000083294.1.46250 WP_000083294.1.46406 WP_000083294.1.46961 WP_000083294.1.47005 WP_000083294.1.47429 WP_000083294.1.47472 WP_000083294.1.47478 WP_000083294.1.47621 WP_000083294.1.47928 WP_000083294.1.48788 WP_000083294.1.4885 WP_000083294.1.48876 WP_000083294.1.49102 WP_000083294.1.49155 WP_000083294.1.49204 WP_000083294.1.49226 WP_000083294.1.49515 WP_000083294.1.49650 WP_000083294.1.49931 WP_000083294.1.50003 WP_000083294.1.50007 WP_000083294.1.50080 WP_000083294.1.50349 WP_000083294.1.50376 WP_000083294.1.50389 WP_000083294.1.50576 WP_000083294.1.51014 WP_000083294.1.51162 WP_000083294.1.51179 WP_000083294.1.51182 WP_000083294.1.51285 WP_000083294.1.51488 WP_000083294.1.51514 WP_000083294.1.51611 WP_000083294.1.51649 WP_000083294.1.51756 WP_000083294.1.52346 WP_000083294.1.52361 WP_000083294.1.52528 WP_000083294.1.52656 WP_000083294.1.52898 WP_000083294.1.53179 WP_000083294.1.53406 WP_000083294.1.53534 WP_000083294.1.54033 WP_000083294.1.54061 WP_000083294.1.54075 WP_000083294.1.54082 WP_000083294.1.54196 WP_000083294.1.54209 WP_000083294.1.54400 WP_000083294.1.54644 WP_000083294.1.54749 WP_000083294.1.54814 WP_000083294.1.5517 WP_000083294.1.55743 WP_000083294.1.55768 WP_000083294.1.56012 WP_000083294.1.56105 WP_000083294.1.56238 WP_000083294.1.56393 WP_000083294.1.56420 WP_000083294.1.56601 WP_000083294.1.56671 WP_000083294.1.56682 WP_000083294.1.56905 WP_000083294.1.57149 WP_000083294.1.57357 WP_000083294.1.57433 WP_000083294.1.57607 WP_000083294.1.57890 WP_000083294.1.57891 WP_000083294.1.57978 WP_000083294.1.58249 WP_000083294.1.58301 WP_000083294.1.58745 WP_000083294.1.58803 WP_000083294.1.5886 WP_000083294.1.59321 WP_000083294.1.59490 WP_000083294.1.59508 WP_000083294.1.59928 WP_000083294.1.60015 WP_000083294.1.60021 WP_000083294.1.60052 WP_000083294.1.60069 WP_000083294.1.60155 WP_000083294.1.60746 WP_000083294.1.60838 WP_000083294.1.60941 WP_000083294.1.61078 WP_000083294.1.61201 WP_000083294.1.61232 WP_000083294.1.61233 WP_000083294.1.61296 WP_000083294.1.61345 WP_000083294.1.61574 WP_000083294.1.61918 WP_000083294.1.61952 WP_000083294.1.62204 WP_000083294.1.62910 WP_000083294.1.62955 WP_000083294.1.63043 WP_000083294.1.63181 WP_000083294.1.63234 WP_000083294.1.63256 WP_000083294.1.63432 WP_000083294.1.63577 WP_000083294.1.63664 WP_000083294.1.63757 WP_000083294.1.63824 WP_000083294.1.63831 WP_000083294.1.63992 WP_000083294.1.6423 WP_000083294.1.64242 WP_000083294.1.64244 WP_000083294.1.64266 WP_000083294.1.6437 WP_000083294.1.64403 WP_000083294.1.64702 WP_000083294.1.64757 WP_000083294.1.6489 WP_000083294.1.64920 WP_000083294.1.6535 WP_000083294.1.6550 WP_000083294.1.6565 WP_000083294.1.6575 WP_000083294.1.65795 WP_000083294.1.65838 WP_000083294.1.66167 WP_000083294.1.6630 WP_000083294.1.66358 WP_000083294.1.66362 WP_000083294.1.66534 WP_000083294.1.66901 WP_000083294.1.66962 WP_000083294.1.67 WP_000083294.1.67037 WP_000083294.1.67184 WP_000083294.1.67268 WP_000083294.1.67347 WP_000083294.1.67374 WP_000083294.1.67465 WP_000083294.1.67552 WP_000083294.1.67829 WP_000083294.1.67924 WP_000083294.1.67942 WP_000083294.1.68073 WP_000083294.1.6849 WP_000083294.1.68629 WP_000083294.1.68656 WP_000083294.1.69006 WP_000083294.1.69058 WP_000083294.1.69146 WP_000083294.1.69255 WP_000083294.1.69288 WP_000083294.1.69397 WP_000083294.1.69704 WP_000083294.1.69754 WP_000083294.1.7014 WP_000083294.1.70183 WP_000083294.1.7021 WP_000083294.1.70326 WP_000083294.1.70488 WP_000083294.1.70523 WP_000083294.1.70547 WP_000083294.1.70580 WP_000083294.1.70683 WP_000083294.1.70712 WP_000083294.1.70883 WP_000083294.1.70922 WP_000083294.1.71116 WP_000083294.1.71146 WP_000083294.1.71188 WP_000083294.1.71202 WP_000083294.1.71248 WP_000083294.1.71337 WP_000083294.1.71378 WP_000083294.1.71702 WP_000083294.1.71845 WP_000083294.1.72376 WP_000083294.1.72382 WP_000083294.1.72827 WP_000083294.1.72871 WP_000083294.1.72872 WP_000083294.1.73144 WP_000083294.1.7315 WP_000083294.1.73200 WP_000083294.1.7334 WP_000083294.1.73377 WP_000083294.1.73753 WP_000083294.1.73924 WP_000083294.1.74029 WP_000083294.1.74117 WP_000083294.1.74191 WP_000083294.1.7433 WP_000083294.1.74379 WP_000083294.1.74410 WP_000083294.1.74466 WP_000083294.1.74529 WP_000083294.1.74992 WP_000083294.1.74996 WP_000083294.1.75129 WP_000083294.1.75187 WP_000083294.1.75288 WP_000083294.1.75362 WP_000083294.1.75764 WP_000083294.1.75793 WP_000083294.1.75837 WP_000083294.1.76208 WP_000083294.1.76301 WP_000083294.1.7660 WP_000083294.1.76673 WP_000083294.1.77047 WP_000083294.1.77080 WP_000083294.1.7712 WP_000083294.1.77349 WP_000083294.1.77414 WP_000083294.1.77529 WP_000083294.1.77543 WP_000083294.1.7782 WP_000083294.1.77898 WP_000083294.1.77960 WP_000083294.1.77971 WP_000083294.1.78245 WP_000083294.1.7861 WP_000083294.1.78673 WP_000083294.1.78874 WP_000083294.1.79151 WP_000083294.1.79167 WP_000083294.1.79203 WP_000083294.1.79335 WP_000083294.1.79472 WP_000083294.1.79490 WP_000083294.1.79495 WP_000083294.1.79570 WP_000083294.1.79659 WP_000083294.1.79708 WP_000083294.1.79845 WP_000083294.1.79966 WP_000083294.1.80077 WP_000083294.1.80137 WP_000083294.1.80651 WP_000083294.1.80667 WP_000083294.1.80674 WP_000083294.1.80750 WP_000083294.1.80831 WP_000083294.1.80939 WP_000083294.1.81193 WP_000083294.1.81321 WP_000083294.1.81667 WP_000083294.1.81750 WP_000083294.1.81785 WP_000083294.1.81902 WP_000083294.1.81974 WP_000083294.1.82337 WP_000083294.1.82395 WP_000083294.1.82479 WP_000083294.1.82515 WP_000083294.1.82529 WP_000083294.1.82584 WP_000083294.1.82676 WP_000083294.1.82761 WP_000083294.1.82895 WP_000083294.1.83061 WP_000083294.1.83092 WP_000083294.1.83119 WP_000083294.1.83305 WP_000083294.1.83413 WP_000083294.1.8354 WP_000083294.1.83960 WP_000083294.1.84103 WP_000083294.1.84392 WP_000083294.1.84554 WP_000083294.1.84659 WP_000083294.1.84683 WP_000083294.1.85134 WP_000083294.1.85180 WP_000083294.1.85190 WP_000083294.1.85483 WP_000083294.1.8552 WP_000083294.1.85617 WP_000083294.1.85672 WP_000083294.1.85675 WP_000083294.1.85900 WP_000083294.1.85976 WP_000083294.1.86092 WP_000083294.1.86335 WP_000083294.1.86601 WP_000083294.1.86810 WP_000083294.1.8684 WP_000083294.1.86906 WP_000083294.1.87095 WP_000083294.1.87552 WP_000083294.1.87945 WP_000083294.1.88019 WP_000083294.1.88073 WP_000083294.1.88792 WP_000083294.1.88981 WP_000083294.1.89008 WP_000083294.1.89304 WP_000083294.1.89452 WP_000083294.1.89512 WP_000083294.1.89527 WP_000083294.1.89570 WP_000083294.1.89622 WP_000083294.1.89965 WP_000083294.1.9002 WP_000083294.1.90252 WP_000083294.1.90417 WP_000083294.1.90453 WP_000083294.1.90458 WP_000083294.1.90734 WP_000083294.1.90984 WP_000083294.1.91003 WP_000083294.1.91459 WP_000083294.1.91564 WP_000083294.1.91655 WP_000083294.1.91914 WP_000083294.1.92183 WP_000083294.1.92208 WP_000083294.1.92268 WP_000083294.1.92439 WP_000083294.1.92443 WP_000083294.1.92482 WP_000083294.1.92531 WP_000083294.1.92671 WP_000083294.1.92738 WP_000083294.1.93136 WP_000083294.1.93155 WP_000083294.1.93365 WP_000083294.1.93596 WP_000083294.1.93650 WP_000083294.1.93656 WP_000083294.1.93705 WP_000083294.1.93994 WP_000083294.1.94072 WP_000083294.1.94458 WP_000083294.1.94565 WP_000083294.1.94584 WP_000083294.1.95051 WP_000083294.1.95121 WP_000083294.1.9516 WP_000083294.1.95546 WP_000083294.1.95630 WP_000083294.1.95826 WP_000083294.1.96343 WP_000083294.1.96500 WP_000083294.1.96563 WP_000083294.1.96798 WP_000083294.1.97043 WP_000083294.1.97109 WP_000083294.1.97145 WP_000083294.1.97736 WP_000083294.1.98006 WP_000083294.1.98019 WP_000083294.1.98110 WP_000083294.1.98146 WP_000083294.1.98219 WP_000083294.1.98314 WP_000083294.1.98551 WP_000083294.1.98577 WP_000083294.1.98676 WP_000083294.1.98677 WP_000083294.1.98947 WP_000083294.1.9898 WP_000083294.1.99098 WP_000083294.1.99267 WP_000083294.1.99712 WP_000083294.1.99813 gi|378989983|ref|YP_005253147.1| gi|16765922|ref|NP_461537.1| 423368.SNSL254_A2808 99287.STM2601 gi|378451352|ref|YP_005238711.1| gi|410023174|ref|YP_005237044.2| gi|169257228|ref|YP_001700605.1| gi|526221105|ref|YP_008266846.1| gi|378985165|ref|YP_005248321.1| gi|482904415|ref|YP_007902975.1| gi|379701837|ref|YP_005243565.1| gi|528820428|ref|YP_008361631.1| gi|549725249|ref|YP_008645439.1| gi|378700504|ref|YP_005182461.1| ABAO01000016|CDS_79179-78796 ABEW01000008|CDS_7721-8104 ABEW01000016|CDS_24910-25293 ABEW01000022|CDS_7721-8104 ABFF01000012|CDS_27772-28155 ABFH02000002|CDS_1024088-1023705 AE006468|CDS_2750465-2750082 CP001113|CDS_2750498-2750115 CP001363|CDS_2801995-2801612 FN424405|CDS_2774822-2774439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]