SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410023222|ref|YP_005240605.2| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410023222|ref|YP_005240605.2|
Domain Number 1 Region: 251-299
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000184
Family AraC type transcriptional activator 0.021
Further Details:      
 
Domain Number 2 Region: 137-194
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 0.0000000000248
Family A DNA-binding domain in eukaryotic transcription factors 0.0051
Further Details:      
 
Domain Number 3 Region: 42-156
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.000000101
Family TM1287-like 0.08
Further Details:      
 
Weak hits

Sequence:  gi|410023222|ref|YP_005240605.2|
Domain Number - Region: 200-249
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000143
Family AraC type transcriptional activator 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410023222|ref|YP_005240605.2|
Sequence length 310
Comment DNA-binding transcriptional regulator MelR [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSTQAISLLPPDPHMCNGDEKQTRSPLSLYSEYQRLDVELRPPHRMASSHWHGQVEVNVP
FDGDVEYLINNEVVQIKQGHITLFWACTPHQLTRPGNCRQMAIFSLPMHLFLSWPLDRDL
INHVTHGMVVKSLATQQLSTFEVLRWQQETSSPNEQIRQLAIDEIGLMLKRFSLSGWQPI
LLNKTSRTHKNSVSRHAQFYVSQMLGFIADNYDQALTINDVAEHVKLNANYAMGIFQRVM
QLTMKQYITAMRINHVRALLSDTDKTILDVALTAGFRSSSRFYSTFSKFVGMSPQQYRKL
SQQRRQTMPG
Download sequence
Identical sequences A0A0F7JCF2 A0A0H3NKL0 A0A0J5EQR5 A0A0L3JNL4 A0A0M0PV83 A0A0R9N0K6 A0A0T7RSZ7 A0A0U1F8W2 A0A1C2ZWB2 A0A1R2ZBM5 A0A1S0ZDJ0 A0A1S1ASW9 A0A1X2RPH0 A0A1X2V962 A0A1X2Y9G9 A0A1Z3Q7H9 A0A221YT72 A0A221Z5P9 A0A265B2K1 A0A267SMG9 A0A271CFY7 A0A271D054 A0A2C6GBG4 A0A2C9P4R0 A0A2D1XIX4 A0A2D1XX23 A0A2D3U162 A0A2G1NQX3 A0A2H9YDS9 A0A2I6MDL0 A0A2I6MR84 A0A2I6N4W9 A0A2I6NIF1 A0A2I6P9A3 A0A2K2Z0P4 E8X9U8 G4C9J4 M7S5J2 Q7CPA6 Q8XH24 S4K658 S5HQY1 V1XGJ9 V7IVA4
gi|207859451|ref|YP_002246102.1| gi|549726811|ref|YP_008647001.1| gi|379703539|ref|YP_005245267.1| gi|378702140|ref|YP_005184098.1| gi|525830472|ref|YP_008250932.1| gi|16762979|ref|NP_458596.1| gi|410023222|ref|YP_005240605.2| gi|16767547|ref|NP_463162.1| gi|482906835|ref|YP_007905395.1| gi|409247973|ref|YP_006888665.1| gi|488656641|ref|YP_007928444.1| gi|525815586|ref|YP_008245604.1| gi|526221878|ref|YP_008263973.1| gi|525859490|ref|YP_008258903.1| APC25564 gi|452121966|ref|YP_007472214.1| 209261.t4204 220341.STY4496 550537.SEN4068 99287.STM4297 gi|378991565|ref|YP_005254729.1| gi|549482411|ref|YP_008615896.1| NP_458596.1.84458 NP_463162.1.58477 WP_000106992.1.100002 WP_000106992.1.100007 WP_000106992.1.100008 WP_000106992.1.100010 WP_000106992.1.100017 WP_000106992.1.100031 WP_000106992.1.100036 WP_000106992.1.100077 WP_000106992.1.100079 WP_000106992.1.100115 WP_000106992.1.100129 WP_000106992.1.10013 WP_000106992.1.100137 WP_000106992.1.100149 WP_000106992.1.100165 WP_000106992.1.100191 WP_000106992.1.100196 WP_000106992.1.1002 WP_000106992.1.100234 WP_000106992.1.100266 WP_000106992.1.100284 WP_000106992.1.100288 WP_000106992.1.100313 WP_000106992.1.100314 WP_000106992.1.100321 WP_000106992.1.100354 WP_000106992.1.100376 WP_000106992.1.100392 WP_000106992.1.100412 WP_000106992.1.100413 WP_000106992.1.100421 WP_000106992.1.100424 WP_000106992.1.100432 WP_000106992.1.100436 WP_000106992.1.100438 WP_000106992.1.100446 WP_000106992.1.100450 WP_000106992.1.100457 WP_000106992.1.100472 WP_000106992.1.100484 WP_000106992.1.100488 WP_000106992.1.100502 WP_000106992.1.100519 WP_000106992.1.100521 WP_000106992.1.100557 WP_000106992.1.100584 WP_000106992.1.100592 WP_000106992.1.100597 WP_000106992.1.100605 WP_000106992.1.100610 WP_000106992.1.100642 WP_000106992.1.10065 WP_000106992.1.100650 WP_000106992.1.100707 WP_000106992.1.100711 WP_000106992.1.100714 WP_000106992.1.100721 WP_000106992.1.100730 WP_000106992.1.100732 WP_000106992.1.100733 WP_000106992.1.100739 WP_000106992.1.10074 WP_000106992.1.100750 WP_000106992.1.100764 WP_000106992.1.100773 WP_000106992.1.100776 WP_000106992.1.100781 WP_000106992.1.100790 WP_000106992.1.100793 WP_000106992.1.100799 WP_000106992.1.10081 WP_000106992.1.100814 WP_000106992.1.100857 WP_000106992.1.100865 WP_000106992.1.100869 WP_000106992.1.100870 WP_000106992.1.100882 WP_000106992.1.100886 WP_000106992.1.100895 WP_000106992.1.100932 WP_000106992.1.100941 WP_000106992.1.100944 WP_000106992.1.100948 WP_000106992.1.100953 WP_000106992.1.101007 WP_000106992.1.101011 WP_000106992.1.101020 WP_000106992.1.101042 WP_000106992.1.101074 WP_000106992.1.101078 WP_000106992.1.10108 WP_000106992.1.101091 WP_000106992.1.101094 WP_000106992.1.101112 WP_000106992.1.101123 WP_000106992.1.101126 WP_000106992.1.101147 WP_000106992.1.101180 WP_000106992.1.101185 WP_000106992.1.101199 WP_000106992.1.101223 WP_000106992.1.101226 WP_000106992.1.10124 WP_000106992.1.101259 WP_000106992.1.101271 WP_000106992.1.101284 WP_000106992.1.101291 WP_000106992.1.1013 WP_000106992.1.101312 WP_000106992.1.101320 WP_000106992.1.101322 WP_000106992.1.101353 WP_000106992.1.101374 WP_000106992.1.101386 WP_000106992.1.101404 WP_000106992.1.101420 WP_000106992.1.101454 WP_000106992.1.101473 WP_000106992.1.101519 WP_000106992.1.101520 WP_000106992.1.101541 WP_000106992.1.101589 WP_000106992.1.101609 WP_000106992.1.101612 WP_000106992.1.101616 WP_000106992.1.101634 WP_000106992.1.101636 WP_000106992.1.101639 WP_000106992.1.10164 WP_000106992.1.101666 WP_000106992.1.101674 WP_000106992.1.101707 WP_000106992.1.101724 WP_000106992.1.101734 WP_000106992.1.101740 WP_000106992.1.101741 WP_000106992.1.101744 WP_000106992.1.101759 WP_000106992.1.10177 WP_000106992.1.101776 WP_000106992.1.101815 WP_000106992.1.101832 WP_000106992.1.101839 WP_000106992.1.101841 WP_000106992.1.101868 WP_000106992.1.101890 WP_000106992.1.10191 WP_000106992.1.101917 WP_000106992.1.101927 WP_000106992.1.101941 WP_000106992.1.101949 WP_000106992.1.101953 WP_000106992.1.101975 WP_000106992.1.102009 WP_000106992.1.102050 WP_000106992.1.102087 WP_000106992.1.102111 WP_000106992.1.10220 WP_000106992.1.10231 WP_000106992.1.10237 WP_000106992.1.10266 WP_000106992.1.10276 WP_000106992.1.10293 WP_000106992.1.10300 WP_000106992.1.10310 WP_000106992.1.10338 WP_000106992.1.1038 WP_000106992.1.10394 WP_000106992.1.104 WP_000106992.1.10401 WP_000106992.1.10428 WP_000106992.1.10429 WP_000106992.1.10439 WP_000106992.1.10459 WP_000106992.1.10463 WP_000106992.1.10465 WP_000106992.1.10475 WP_000106992.1.10498 WP_000106992.1.10507 WP_000106992.1.10511 WP_000106992.1.10514 WP_000106992.1.10521 WP_000106992.1.10530 WP_000106992.1.10532 WP_000106992.1.10547 WP_000106992.1.10562 WP_000106992.1.10566 WP_000106992.1.10568 WP_000106992.1.10595 WP_000106992.1.106 WP_000106992.1.10631 WP_000106992.1.10642 WP_000106992.1.10654 WP_000106992.1.10675 WP_000106992.1.10677 WP_000106992.1.10678 WP_000106992.1.10711 WP_000106992.1.10720 WP_000106992.1.10753 WP_000106992.1.10755 WP_000106992.1.10797 WP_000106992.1.10857 WP_000106992.1.10868 WP_000106992.1.10873 WP_000106992.1.10898 WP_000106992.1.10926 WP_000106992.1.10936 WP_000106992.1.10992 WP_000106992.1.11012 WP_000106992.1.11024 WP_000106992.1.11031 WP_000106992.1.11041 WP_000106992.1.11055 WP_000106992.1.11098 WP_000106992.1.1110 WP_000106992.1.11119 WP_000106992.1.11126 WP_000106992.1.11142 WP_000106992.1.11156 WP_000106992.1.11168 WP_000106992.1.11190 WP_000106992.1.11213 WP_000106992.1.11216 WP_000106992.1.11239 WP_000106992.1.11253 WP_000106992.1.11254 WP_000106992.1.11295 WP_000106992.1.113 WP_000106992.1.11304 WP_000106992.1.11314 WP_000106992.1.1135 WP_000106992.1.11362 WP_000106992.1.11369 WP_000106992.1.1137 WP_000106992.1.11385 WP_000106992.1.11405 WP_000106992.1.1142 WP_000106992.1.11426 WP_000106992.1.11429 WP_000106992.1.11444 WP_000106992.1.11455 WP_000106992.1.11458 WP_000106992.1.11479 WP_000106992.1.1150 WP_000106992.1.11511 WP_000106992.1.11518 WP_000106992.1.11526 WP_000106992.1.11528 WP_000106992.1.11532 WP_000106992.1.11544 WP_000106992.1.11557 WP_000106992.1.1156 WP_000106992.1.11565 WP_000106992.1.11588 WP_000106992.1.11603 WP_000106992.1.11638 WP_000106992.1.11677 WP_000106992.1.11681 WP_000106992.1.11687 WP_000106992.1.1169 WP_000106992.1.11735 WP_000106992.1.1174 WP_000106992.1.11763 WP_000106992.1.11772 WP_000106992.1.11824 WP_000106992.1.11834 WP_000106992.1.11841 WP_000106992.1.11865 WP_000106992.1.11868 WP_000106992.1.11875 WP_000106992.1.11883 WP_000106992.1.11897 WP_000106992.1.11900 WP_000106992.1.11908 WP_000106992.1.11914 WP_000106992.1.11936 WP_000106992.1.11964 WP_000106992.1.11978 WP_000106992.1.12007 WP_000106992.1.12017 WP_000106992.1.12027 WP_000106992.1.12040 WP_000106992.1.12047 WP_000106992.1.12059 WP_000106992.1.12061 WP_000106992.1.12063 WP_000106992.1.1207 WP_000106992.1.12106 WP_000106992.1.12114 WP_000106992.1.12141 WP_000106992.1.12144 WP_000106992.1.1215 WP_000106992.1.12159 WP_000106992.1.12160 WP_000106992.1.12168 WP_000106992.1.12172 WP_000106992.1.12192 WP_000106992.1.1224 WP_000106992.1.12244 WP_000106992.1.12280 WP_000106992.1.12282 WP_000106992.1.12340 WP_000106992.1.12351 WP_000106992.1.12364 WP_000106992.1.12370 WP_000106992.1.12374 WP_000106992.1.1239 WP_000106992.1.12396 WP_000106992.1.12397 WP_000106992.1.12398 WP_000106992.1.12441 WP_000106992.1.12456 WP_000106992.1.1246 WP_000106992.1.12472 WP_000106992.1.12484 WP_000106992.1.12485 WP_000106992.1.1250 WP_000106992.1.12546 WP_000106992.1.12568 WP_000106992.1.12569 WP_000106992.1.12581 WP_000106992.1.12584 WP_000106992.1.12585 WP_000106992.1.12620 WP_000106992.1.1264 WP_000106992.1.12648 WP_000106992.1.12650 WP_000106992.1.12683 WP_000106992.1.12696 WP_000106992.1.12701 WP_000106992.1.12718 WP_000106992.1.12726 WP_000106992.1.12727 WP_000106992.1.12728 WP_000106992.1.12741 WP_000106992.1.12834 WP_000106992.1.12864 WP_000106992.1.12877 WP_000106992.1.12879 WP_000106992.1.12936 WP_000106992.1.1299 WP_000106992.1.12995 WP_000106992.1.1300 WP_000106992.1.13027 WP_000106992.1.13076 WP_000106992.1.13101 WP_000106992.1.13102 WP_000106992.1.13108 WP_000106992.1.13130 WP_000106992.1.13161 WP_000106992.1.13207 WP_000106992.1.1321 WP_000106992.1.13247 WP_000106992.1.1326 WP_000106992.1.13268 WP_000106992.1.13274 WP_000106992.1.13291 WP_000106992.1.133 WP_000106992.1.13311 WP_000106992.1.13314 WP_000106992.1.13338 WP_000106992.1.13342 WP_000106992.1.13352 WP_000106992.1.13367 WP_000106992.1.13391 WP_000106992.1.13406 WP_000106992.1.13414 WP_000106992.1.13429 WP_000106992.1.13440 WP_000106992.1.13443 WP_000106992.1.13446 WP_000106992.1.1346 WP_000106992.1.13476 WP_000106992.1.13488 WP_000106992.1.13509 WP_000106992.1.13528 WP_000106992.1.13543 WP_000106992.1.13573 WP_000106992.1.13599 WP_000106992.1.13625 WP_000106992.1.13661 WP_000106992.1.13669 WP_000106992.1.13677 WP_000106992.1.13686 WP_000106992.1.13691 WP_000106992.1.1372 WP_000106992.1.13732 WP_000106992.1.13741 WP_000106992.1.13750 WP_000106992.1.13764 WP_000106992.1.13799 WP_000106992.1.13819 WP_000106992.1.1382 WP_000106992.1.13827 WP_000106992.1.13829 WP_000106992.1.13848 WP_000106992.1.13857 WP_000106992.1.1387 WP_000106992.1.13908 WP_000106992.1.13932 WP_000106992.1.13968 WP_000106992.1.1397 WP_000106992.1.13972 WP_000106992.1.140 WP_000106992.1.14001 WP_000106992.1.1401 WP_000106992.1.14011 WP_000106992.1.14041 WP_000106992.1.14050 WP_000106992.1.14056 WP_000106992.1.1408 WP_000106992.1.14089 WP_000106992.1.14099 WP_000106992.1.14111 WP_000106992.1.1412 WP_000106992.1.14120 WP_000106992.1.14123 WP_000106992.1.14150 WP_000106992.1.14151 WP_000106992.1.14191 WP_000106992.1.14197 WP_000106992.1.14212 WP_000106992.1.14239 WP_000106992.1.14280 WP_000106992.1.14286 WP_000106992.1.14296 WP_000106992.1.14320 WP_000106992.1.14333 WP_000106992.1.14369 WP_000106992.1.14399 WP_000106992.1.1440 WP_000106992.1.14406 WP_000106992.1.14410 WP_000106992.1.14436 WP_000106992.1.14444 WP_000106992.1.14446 WP_000106992.1.14458 WP_000106992.1.14466 WP_000106992.1.14467 WP_000106992.1.14474 WP_000106992.1.14495 WP_000106992.1.14500 WP_000106992.1.14516 WP_000106992.1.14524 WP_000106992.1.14526 WP_000106992.1.14528 WP_000106992.1.14550 WP_000106992.1.14554 WP_000106992.1.14575 WP_000106992.1.146 WP_000106992.1.14618 WP_000106992.1.14688 WP_000106992.1.14701 WP_000106992.1.14703 WP_000106992.1.14706 WP_000106992.1.14708 WP_000106992.1.14719 WP_000106992.1.14725 WP_000106992.1.1473 WP_000106992.1.14737 WP_000106992.1.14765 WP_000106992.1.14789 WP_000106992.1.14793 WP_000106992.1.14808 WP_000106992.1.14810 WP_000106992.1.14819 WP_000106992.1.14852 WP_000106992.1.14876 WP_000106992.1.14877 WP_000106992.1.14884 WP_000106992.1.1489 WP_000106992.1.14894 WP_000106992.1.14913 WP_000106992.1.14917 WP_000106992.1.14927 WP_000106992.1.14930 WP_000106992.1.14932 WP_000106992.1.14936 WP_000106992.1.14947 WP_000106992.1.14948 WP_000106992.1.14964 WP_000106992.1.15046 WP_000106992.1.15054 WP_000106992.1.15055 WP_000106992.1.15059 WP_000106992.1.15067 WP_000106992.1.15079 WP_000106992.1.15100 WP_000106992.1.15102 WP_000106992.1.15124 WP_000106992.1.15184 WP_000106992.1.15214 WP_000106992.1.15223 WP_000106992.1.15226 WP_000106992.1.15244 WP_000106992.1.15265 WP_000106992.1.15276 WP_000106992.1.15316 WP_000106992.1.15318 WP_000106992.1.15353 WP_000106992.1.15362 WP_000106992.1.15369 WP_000106992.1.1540 WP_000106992.1.15415 WP_000106992.1.15423 WP_000106992.1.15433 WP_000106992.1.15439 WP_000106992.1.15479 WP_000106992.1.15483 WP_000106992.1.15487 WP_000106992.1.15508 WP_000106992.1.1551 WP_000106992.1.15535 WP_000106992.1.15581 WP_000106992.1.15585 WP_000106992.1.15586 WP_000106992.1.15597 WP_000106992.1.15612 WP_000106992.1.15616 WP_000106992.1.15625 WP_000106992.1.15627 WP_000106992.1.15644 WP_000106992.1.1568 WP_000106992.1.15708 WP_000106992.1.15710 WP_000106992.1.15717 WP_000106992.1.15775 WP_000106992.1.15777 WP_000106992.1.15784 WP_000106992.1.15795 WP_000106992.1.158 WP_000106992.1.15830 WP_000106992.1.15835 WP_000106992.1.15862 WP_000106992.1.15881 WP_000106992.1.15905 WP_000106992.1.15909 WP_000106992.1.15910 WP_000106992.1.15912 WP_000106992.1.1592 WP_000106992.1.15922 WP_000106992.1.15970 WP_000106992.1.15978 WP_000106992.1.15986 WP_000106992.1.15995 WP_000106992.1.16000 WP_000106992.1.16004 WP_000106992.1.16006 WP_000106992.1.1601 WP_000106992.1.16028 WP_000106992.1.16032 WP_000106992.1.16046 WP_000106992.1.16047 WP_000106992.1.16051 WP_000106992.1.16052 WP_000106992.1.16058 WP_000106992.1.16062 WP_000106992.1.16063 WP_000106992.1.16103 WP_000106992.1.1611 WP_000106992.1.16125 WP_000106992.1.16150 WP_000106992.1.16155 WP_000106992.1.16158 WP_000106992.1.16166 WP_000106992.1.16172 WP_000106992.1.16201 WP_000106992.1.16226 WP_000106992.1.16233 WP_000106992.1.16244 WP_000106992.1.1626 WP_000106992.1.16264 WP_000106992.1.16273 WP_000106992.1.16284 WP_000106992.1.16328 WP_000106992.1.16331 WP_000106992.1.16344 WP_000106992.1.1635 WP_000106992.1.16361 WP_000106992.1.16363 WP_000106992.1.16365 WP_000106992.1.16366 WP_000106992.1.16394 WP_000106992.1.16452 WP_000106992.1.16461 WP_000106992.1.16462 WP_000106992.1.16465 WP_000106992.1.16468 WP_000106992.1.16474 WP_000106992.1.16508 WP_000106992.1.16522 WP_000106992.1.16525 WP_000106992.1.16551 WP_000106992.1.16565 WP_000106992.1.16581 WP_000106992.1.16588 WP_000106992.1.16614 WP_000106992.1.16650 WP_000106992.1.16656 WP_000106992.1.16658 WP_000106992.1.16666 WP_000106992.1.16673 WP_000106992.1.1668 WP_000106992.1.16686 WP_000106992.1.16691 WP_000106992.1.16729 WP_000106992.1.16732 WP_000106992.1.16735 WP_000106992.1.1674 WP_000106992.1.16767 WP_000106992.1.16781 WP_000106992.1.16786 WP_000106992.1.16804 WP_000106992.1.16817 WP_000106992.1.16819 WP_000106992.1.16826 WP_000106992.1.16846 WP_000106992.1.16855 WP_000106992.1.16858 WP_000106992.1.16873 WP_000106992.1.16879 WP_000106992.1.1689 WP_000106992.1.16893 WP_000106992.1.16896 WP_000106992.1.16903 WP_000106992.1.16905 WP_000106992.1.16910 WP_000106992.1.16916 WP_000106992.1.16941 WP_000106992.1.16942 WP_000106992.1.16944 WP_000106992.1.16948 WP_000106992.1.16965 WP_000106992.1.16972 WP_000106992.1.16998 WP_000106992.1.1700 WP_000106992.1.17031 WP_000106992.1.17049 WP_000106992.1.17058 WP_000106992.1.17060 WP_000106992.1.17078 WP_000106992.1.17093 WP_000106992.1.17098 WP_000106992.1.17105 WP_000106992.1.17188 WP_000106992.1.17202 WP_000106992.1.17219 WP_000106992.1.1722 WP_000106992.1.17270 WP_000106992.1.17285 WP_000106992.1.17302 WP_000106992.1.17307 WP_000106992.1.17308 WP_000106992.1.1733 WP_000106992.1.17368 WP_000106992.1.1737 WP_000106992.1.17390 WP_000106992.1.174 WP_000106992.1.17405 WP_000106992.1.17406 WP_000106992.1.17439 WP_000106992.1.17447 WP_000106992.1.17480 WP_000106992.1.17482 WP_000106992.1.1749 WP_000106992.1.17504 WP_000106992.1.17513 WP_000106992.1.17525 WP_000106992.1.17543 WP_000106992.1.17546 WP_000106992.1.17560 WP_000106992.1.17563 WP_000106992.1.1757 WP_000106992.1.17578 WP_000106992.1.17583 WP_000106992.1.17622 WP_000106992.1.17629 WP_000106992.1.17659 WP_000106992.1.17667 WP_000106992.1.17686 WP_000106992.1.17693 WP_000106992.1.17702 WP_000106992.1.17703 WP_000106992.1.17705 WP_000106992.1.17732 WP_000106992.1.17741 WP_000106992.1.17743 WP_000106992.1.17755 WP_000106992.1.17840 WP_000106992.1.17865 WP_000106992.1.17886 WP_000106992.1.17891 WP_000106992.1.17901 WP_000106992.1.17914 WP_000106992.1.17919 WP_000106992.1.17936 WP_000106992.1.17949 WP_000106992.1.17956 WP_000106992.1.1798 WP_000106992.1.17991 WP_000106992.1.18005 WP_000106992.1.1801 WP_000106992.1.18019 WP_000106992.1.18021 WP_000106992.1.18022 WP_000106992.1.18056 WP_000106992.1.18061 WP_000106992.1.1807 WP_000106992.1.18089 WP_000106992.1.18092 WP_000106992.1.18099 WP_000106992.1.18103 WP_000106992.1.18109 WP_000106992.1.18111 WP_000106992.1.18122 WP_000106992.1.18124 WP_000106992.1.1814 WP_000106992.1.18144 WP_000106992.1.18149 WP_000106992.1.18163 WP_000106992.1.18173 WP_000106992.1.18177 WP_000106992.1.18178 WP_000106992.1.1818 WP_000106992.1.18192 WP_000106992.1.18249 WP_000106992.1.1825 WP_000106992.1.18254 WP_000106992.1.18265 WP_000106992.1.18267 WP_000106992.1.18270 WP_000106992.1.18277 WP_000106992.1.18280 WP_000106992.1.18281 WP_000106992.1.18282 WP_000106992.1.18328 WP_000106992.1.18358 WP_000106992.1.18365 WP_000106992.1.18370 WP_000106992.1.18384 WP_000106992.1.18406 WP_000106992.1.18426 WP_000106992.1.18441 WP_000106992.1.18445 WP_000106992.1.18468 WP_000106992.1.18474 WP_000106992.1.18485 WP_000106992.1.18489 WP_000106992.1.18513 WP_000106992.1.18607 WP_000106992.1.18610 WP_000106992.1.18641 WP_000106992.1.18678 WP_000106992.1.18686 WP_000106992.1.18692 WP_000106992.1.18705 WP_000106992.1.18715 WP_000106992.1.18722 WP_000106992.1.18737 WP_000106992.1.18766 WP_000106992.1.18776 WP_000106992.1.1880 WP_000106992.1.18822 WP_000106992.1.18847 WP_000106992.1.1885 WP_000106992.1.18860 WP_000106992.1.18881 WP_000106992.1.18886 WP_000106992.1.18895 WP_000106992.1.18919 WP_000106992.1.18922 WP_000106992.1.18940 WP_000106992.1.18949 WP_000106992.1.1895 WP_000106992.1.18959 WP_000106992.1.1897 WP_000106992.1.18972 WP_000106992.1.19001 WP_000106992.1.19006 WP_000106992.1.19030 WP_000106992.1.19038 WP_000106992.1.19044 WP_000106992.1.19053 WP_000106992.1.19055 WP_000106992.1.19064 WP_000106992.1.19084 WP_000106992.1.19093 WP_000106992.1.19163 WP_000106992.1.19174 WP_000106992.1.19187 WP_000106992.1.19228 WP_000106992.1.19240 WP_000106992.1.19273 WP_000106992.1.19288 WP_000106992.1.19291 WP_000106992.1.19300 WP_000106992.1.19320 WP_000106992.1.19340 WP_000106992.1.19357 WP_000106992.1.1939 WP_000106992.1.19405 WP_000106992.1.19422 WP_000106992.1.19433 WP_000106992.1.19454 WP_000106992.1.19456 WP_000106992.1.19458 WP_000106992.1.19460 WP_000106992.1.19461 WP_000106992.1.19469 WP_000106992.1.19496 WP_000106992.1.19535 WP_000106992.1.19538 WP_000106992.1.1955 WP_000106992.1.19588 WP_000106992.1.19589 WP_000106992.1.19614 WP_000106992.1.19616 WP_000106992.1.19642 WP_000106992.1.19656 WP_000106992.1.19660 WP_000106992.1.19663 WP_000106992.1.1968 WP_000106992.1.19683 WP_000106992.1.19686 WP_000106992.1.19702 WP_000106992.1.19706 WP_000106992.1.19723 WP_000106992.1.19724 WP_000106992.1.19731 WP_000106992.1.19740 WP_000106992.1.19749 WP_000106992.1.19784 WP_000106992.1.19793 WP_000106992.1.19794 WP_000106992.1.19802 WP_000106992.1.19809 WP_000106992.1.19823 WP_000106992.1.19834 WP_000106992.1.19851 WP_000106992.1.19863 WP_000106992.1.19867 WP_000106992.1.1990 WP_000106992.1.1992 WP_000106992.1.19967 WP_000106992.1.19970 WP_000106992.1.19975 WP_000106992.1.1998 WP_000106992.1.19999 WP_000106992.1.20 WP_000106992.1.20023 WP_000106992.1.20034 WP_000106992.1.20081 WP_000106992.1.20086 WP_000106992.1.20091 WP_000106992.1.2010 WP_000106992.1.20119 WP_000106992.1.20212 WP_000106992.1.20218 WP_000106992.1.20254 WP_000106992.1.20255 WP_000106992.1.2026 WP_000106992.1.20261 WP_000106992.1.20266 WP_000106992.1.20271 WP_000106992.1.20296 WP_000106992.1.20339 WP_000106992.1.20349 WP_000106992.1.2036 WP_000106992.1.20362 WP_000106992.1.20364 WP_000106992.1.20376 WP_000106992.1.20391 WP_000106992.1.2041 WP_000106992.1.20415 WP_000106992.1.20419 WP_000106992.1.20425 WP_000106992.1.20437 WP_000106992.1.20443 WP_000106992.1.20446 WP_000106992.1.20465 WP_000106992.1.20488 WP_000106992.1.20492 WP_000106992.1.20503 WP_000106992.1.20525 WP_000106992.1.2053 WP_000106992.1.2054 WP_000106992.1.20553 WP_000106992.1.20614 WP_000106992.1.20626 WP_000106992.1.20631 WP_000106992.1.20635 WP_000106992.1.20646 WP_000106992.1.20695 WP_000106992.1.20700 WP_000106992.1.20718 WP_000106992.1.20721 WP_000106992.1.2073 WP_000106992.1.20740 WP_000106992.1.20760 WP_000106992.1.20767 WP_000106992.1.20787 WP_000106992.1.20789 WP_000106992.1.20795 WP_000106992.1.20810 WP_000106992.1.20828 WP_000106992.1.20839 WP_000106992.1.20862 WP_000106992.1.2087 WP_000106992.1.20883 WP_000106992.1.20886 WP_000106992.1.20894 WP_000106992.1.20900 WP_000106992.1.2091 WP_000106992.1.20947 WP_000106992.1.20953 WP_000106992.1.2101 WP_000106992.1.21010 WP_000106992.1.21049 WP_000106992.1.2106 WP_000106992.1.21062 WP_000106992.1.2107 WP_000106992.1.21075 WP_000106992.1.21079 WP_000106992.1.21086 WP_000106992.1.21089 WP_000106992.1.21103 WP_000106992.1.21136 WP_000106992.1.21144 WP_000106992.1.21146 WP_000106992.1.2116 WP_000106992.1.21162 WP_000106992.1.21165 WP_000106992.1.21181 WP_000106992.1.21184 WP_000106992.1.21185 WP_000106992.1.21194 WP_000106992.1.21202 WP_000106992.1.21241 WP_000106992.1.21245 WP_000106992.1.21246 WP_000106992.1.21260 WP_000106992.1.21269 WP_000106992.1.21286 WP_000106992.1.2130 WP_000106992.1.21309 WP_000106992.1.21326 WP_000106992.1.21332 WP_000106992.1.21351 WP_000106992.1.21362 WP_000106992.1.21366 WP_000106992.1.21399 WP_000106992.1.21400 WP_000106992.1.21404 WP_000106992.1.21423 WP_000106992.1.21443 WP_000106992.1.2146 WP_000106992.1.21473 WP_000106992.1.21492 WP_000106992.1.21497 WP_000106992.1.21499 WP_000106992.1.21603 WP_000106992.1.21616 WP_000106992.1.2166 WP_000106992.1.21674 WP_000106992.1.21681 WP_000106992.1.21692 WP_000106992.1.21715 WP_000106992.1.21728 WP_000106992.1.21730 WP_000106992.1.21750 WP_000106992.1.21751 WP_000106992.1.21757 WP_000106992.1.21792 WP_000106992.1.21825 WP_000106992.1.21845 WP_000106992.1.21886 WP_000106992.1.21909 WP_000106992.1.21910 WP_000106992.1.21940 WP_000106992.1.21946 WP_000106992.1.21950 WP_000106992.1.21966 WP_000106992.1.21981 WP_000106992.1.21991 WP_000106992.1.22019 WP_000106992.1.22024 WP_000106992.1.22030 WP_000106992.1.2205 WP_000106992.1.22051 WP_000106992.1.22062 WP_000106992.1.22064 WP_000106992.1.22067 WP_000106992.1.22069 WP_000106992.1.22096 WP_000106992.1.22117 WP_000106992.1.22118 WP_000106992.1.22126 WP_000106992.1.22136 WP_000106992.1.22158 WP_000106992.1.2216 WP_000106992.1.22162 WP_000106992.1.22169 WP_000106992.1.22205 WP_000106992.1.22208 WP_000106992.1.2221 WP_000106992.1.22235 WP_000106992.1.2224 WP_000106992.1.22240 WP_000106992.1.2227 WP_000106992.1.22296 WP_000106992.1.22315 WP_000106992.1.22337 WP_000106992.1.22346 WP_000106992.1.2235 WP_000106992.1.22373 WP_000106992.1.22379 WP_000106992.1.22388 WP_000106992.1.22427 WP_000106992.1.22449 WP_000106992.1.22453 WP_000106992.1.22454 WP_000106992.1.2246 WP_000106992.1.22476 WP_000106992.1.22485 WP_000106992.1.22514 WP_000106992.1.22565 WP_000106992.1.22575 WP_000106992.1.22590 WP_000106992.1.22595 WP_000106992.1.22604 WP_000106992.1.22605 WP_000106992.1.22614 WP_000106992.1.22620 WP_000106992.1.22623 WP_000106992.1.22652 WP_000106992.1.22676 WP_000106992.1.22683 WP_000106992.1.22692 WP_000106992.1.22758 WP_000106992.1.22760 WP_000106992.1.2283 WP_000106992.1.2284 WP_000106992.1.22845 WP_000106992.1.22855 WP_000106992.1.22857 WP_000106992.1.22864 WP_000106992.1.22870 WP_000106992.1.22880 WP_000106992.1.22895 WP_000106992.1.22902 WP_000106992.1.22926 WP_000106992.1.22943 WP_000106992.1.22947 WP_000106992.1.22966 WP_000106992.1.22967 WP_000106992.1.22979 WP_000106992.1.23010 WP_000106992.1.23040 WP_000106992.1.23053 WP_000106992.1.23058 WP_000106992.1.23080 WP_000106992.1.23102 WP_000106992.1.23114 WP_000106992.1.2314 WP_000106992.1.23148 WP_000106992.1.23155 WP_000106992.1.23169 WP_000106992.1.23172 WP_000106992.1.23175 WP_000106992.1.23192 WP_000106992.1.23201 WP_000106992.1.23218 WP_000106992.1.2324 WP_000106992.1.23246 WP_000106992.1.23258 WP_000106992.1.23259 WP_000106992.1.23274 WP_000106992.1.23279 WP_000106992.1.23309 WP_000106992.1.23311 WP_000106992.1.2332 WP_000106992.1.23329 WP_000106992.1.23340 WP_000106992.1.23343 WP_000106992.1.2336 WP_000106992.1.23365 WP_000106992.1.23379 WP_000106992.1.23409 WP_000106992.1.23412 WP_000106992.1.2342 WP_000106992.1.23426 WP_000106992.1.23442 WP_000106992.1.23444 WP_000106992.1.23460 WP_000106992.1.23466 WP_000106992.1.23472 WP_000106992.1.23482 WP_000106992.1.23485 WP_000106992.1.23492 WP_000106992.1.235 WP_000106992.1.23500 WP_000106992.1.23503 WP_000106992.1.23509 WP_000106992.1.23513 WP_000106992.1.23515 WP_000106992.1.23529 WP_000106992.1.23548 WP_000106992.1.23571 WP_000106992.1.2358 WP_000106992.1.23587 WP_000106992.1.23604 WP_000106992.1.23629 WP_000106992.1.23631 WP_000106992.1.23634 WP_000106992.1.23639 WP_000106992.1.2364 WP_000106992.1.23643 WP_000106992.1.23646 WP_000106992.1.23670 WP_000106992.1.23675 WP_000106992.1.23679 WP_000106992.1.23685 WP_000106992.1.237 WP_000106992.1.23720 WP_000106992.1.23728 WP_000106992.1.23736 WP_000106992.1.23746 WP_000106992.1.2375 WP_000106992.1.23755 WP_000106992.1.2376 WP_000106992.1.23783 WP_000106992.1.23786 WP_000106992.1.23787 WP_000106992.1.2380 WP_000106992.1.23801 WP_000106992.1.23819 WP_000106992.1.23932 WP_000106992.1.23959 WP_000106992.1.24017 WP_000106992.1.24028 WP_000106992.1.24061 WP_000106992.1.24082 WP_000106992.1.24083 WP_000106992.1.24117 WP_000106992.1.24125 WP_000106992.1.24138 WP_000106992.1.24145 WP_000106992.1.2415 WP_000106992.1.24153 WP_000106992.1.24158 WP_000106992.1.24206 WP_000106992.1.24214 WP_000106992.1.24250 WP_000106992.1.24259 WP_000106992.1.24291 WP_000106992.1.24297 WP_000106992.1.24303 WP_000106992.1.24308 WP_000106992.1.24322 WP_000106992.1.24325 WP_000106992.1.24355 WP_000106992.1.24361 WP_000106992.1.24375 WP_000106992.1.24392 WP_000106992.1.24400 WP_000106992.1.24408 WP_000106992.1.24409 WP_000106992.1.24412 WP_000106992.1.24419 WP_000106992.1.24420 WP_000106992.1.24444 WP_000106992.1.24450 WP_000106992.1.24494 WP_000106992.1.24521 WP_000106992.1.24555 WP_000106992.1.24567 WP_000106992.1.24578 WP_000106992.1.24619 WP_000106992.1.24643 WP_000106992.1.2467 WP_000106992.1.24673 WP_000106992.1.24686 WP_000106992.1.24688 WP_000106992.1.24689 WP_000106992.1.24696 WP_000106992.1.24716 WP_000106992.1.24723 WP_000106992.1.24727 WP_000106992.1.24737 WP_000106992.1.24779 WP_000106992.1.24803 WP_000106992.1.2481 WP_000106992.1.24837 WP_000106992.1.24839 WP_000106992.1.24873 WP_000106992.1.24901 WP_000106992.1.24944 WP_000106992.1.24964 WP_000106992.1.24995 WP_000106992.1.25008 WP_000106992.1.25015 WP_000106992.1.25017 WP_000106992.1.25032 WP_000106992.1.25036 WP_000106992.1.25041 WP_000106992.1.25053 WP_000106992.1.25064 WP_000106992.1.25072 WP_000106992.1.25119 WP_000106992.1.25130 WP_000106992.1.25159 WP_000106992.1.25175 WP_000106992.1.25185 WP_000106992.1.25196 WP_000106992.1.25205 WP_000106992.1.25210 WP_000106992.1.25217 WP_000106992.1.25219 WP_000106992.1.2525 WP_000106992.1.25297 WP_000106992.1.25304 WP_000106992.1.25354 WP_000106992.1.25374 WP_000106992.1.25397 WP_000106992.1.25405 WP_000106992.1.25421 WP_000106992.1.25426 WP_000106992.1.25454 WP_000106992.1.25475 WP_000106992.1.25490 WP_000106992.1.25493 WP_000106992.1.25498 WP_000106992.1.25508 WP_000106992.1.25512 WP_000106992.1.25514 WP_000106992.1.2554 WP_000106992.1.25546 WP_000106992.1.25564 WP_000106992.1.25596 WP_000106992.1.25603 WP_000106992.1.25618 WP_000106992.1.2562 WP_000106992.1.25666 WP_000106992.1.25668 WP_000106992.1.2568 WP_000106992.1.25690 WP_000106992.1.2570 WP_000106992.1.25700 WP_000106992.1.25703 WP_000106992.1.25708 WP_000106992.1.25709 WP_000106992.1.25740 WP_000106992.1.25780 WP_000106992.1.25807 WP_000106992.1.25809 WP_000106992.1.2581 WP_000106992.1.25814 WP_000106992.1.25821 WP_000106992.1.25825 WP_000106992.1.25833 WP_000106992.1.25835 WP_000106992.1.25882 WP_000106992.1.25911 WP_000106992.1.25928 WP_000106992.1.25932 WP_000106992.1.25951 WP_000106992.1.25962 WP_000106992.1.25963 WP_000106992.1.25988 WP_000106992.1.26001 WP_000106992.1.26027 WP_000106992.1.26030 WP_000106992.1.26034 WP_000106992.1.26075 WP_000106992.1.26083 WP_000106992.1.26093 WP_000106992.1.26107 WP_000106992.1.26123 WP_000106992.1.26129 WP_000106992.1.2615 WP_000106992.1.26194 WP_000106992.1.26199 WP_000106992.1.26213 WP_000106992.1.26217 WP_000106992.1.26224 WP_000106992.1.26230 WP_000106992.1.26232 WP_000106992.1.26269 WP_000106992.1.26272 WP_000106992.1.26282 WP_000106992.1.26286 WP_000106992.1.26288 WP_000106992.1.26311 WP_000106992.1.26319 WP_000106992.1.2634 WP_000106992.1.26363 WP_000106992.1.26384 WP_000106992.1.26394 WP_000106992.1.26426 WP_000106992.1.26429 WP_000106992.1.26440 WP_000106992.1.26441 WP_000106992.1.26491 WP_000106992.1.26493 WP_000106992.1.26512 WP_000106992.1.26532 WP_000106992.1.2654 WP_000106992.1.26551 WP_000106992.1.26554 WP_000106992.1.26563 WP_000106992.1.26567 WP_000106992.1.26576 WP_000106992.1.26582 WP_000106992.1.26587 WP_000106992.1.2660 WP_000106992.1.26636 WP_000106992.1.26646 WP_000106992.1.2667 WP_000106992.1.26687 WP_000106992.1.26689 WP_000106992.1.26709 WP_000106992.1.2672 WP_000106992.1.26741 WP_000106992.1.26758 WP_000106992.1.26787 WP_000106992.1.2679 WP_000106992.1.26794 WP_000106992.1.26833 WP_000106992.1.26856 WP_000106992.1.26882 WP_000106992.1.26883 WP_000106992.1.26892 WP_000106992.1.26908 WP_000106992.1.26919 WP_000106992.1.2692 WP_000106992.1.26924 WP_000106992.1.26928 WP_000106992.1.26936 WP_000106992.1.26980 WP_000106992.1.270 WP_000106992.1.27008 WP_000106992.1.27010 WP_000106992.1.27027 WP_000106992.1.27051 WP_000106992.1.27055 WP_000106992.1.27070 WP_000106992.1.27072 WP_000106992.1.27077 WP_000106992.1.27084 WP_000106992.1.27086 WP_000106992.1.27087 WP_000106992.1.27111 WP_000106992.1.27115 WP_000106992.1.27122 WP_000106992.1.2713 WP_000106992.1.27169 WP_000106992.1.2717 WP_000106992.1.27173 WP_000106992.1.272 WP_000106992.1.27206 WP_000106992.1.27223 WP_000106992.1.27228 WP_000106992.1.2723 WP_000106992.1.27255 WP_000106992.1.27272 WP_000106992.1.27279 WP_000106992.1.27282 WP_000106992.1.27285 WP_000106992.1.27309 WP_000106992.1.27314 WP_000106992.1.27329 WP_000106992.1.27342 WP_000106992.1.27361 WP_000106992.1.27383 WP_000106992.1.27419 WP_000106992.1.27452 WP_000106992.1.27513 WP_000106992.1.27522 WP_000106992.1.27523 WP_000106992.1.27535 WP_000106992.1.27544 WP_000106992.1.27547 WP_000106992.1.27556 WP_000106992.1.27561 WP_000106992.1.27565 WP_000106992.1.27595 WP_000106992.1.27598 WP_000106992.1.27616 WP_000106992.1.2763 WP_000106992.1.27632 WP_000106992.1.27638 WP_000106992.1.27655 WP_000106992.1.27658 WP_000106992.1.27665 WP_000106992.1.27679 WP_000106992.1.27706 WP_000106992.1.27707 WP_000106992.1.27713 WP_000106992.1.27755 WP_000106992.1.27761 WP_000106992.1.2777 WP_000106992.1.27775 WP_000106992.1.27776 WP_000106992.1.27785 WP_000106992.1.27798 WP_000106992.1.27800 WP_000106992.1.27833 WP_000106992.1.27857 WP_000106992.1.27883 WP_000106992.1.27900 WP_000106992.1.27928 WP_000106992.1.27945 WP_000106992.1.27977 WP_000106992.1.27995 WP_000106992.1.27997 WP_000106992.1.28002 WP_000106992.1.28004 WP_000106992.1.28032 WP_000106992.1.28037 WP_000106992.1.28056 WP_000106992.1.2806 WP_000106992.1.28073 WP_000106992.1.2809 WP_000106992.1.28094 WP_000106992.1.28116 WP_000106992.1.28139 WP_000106992.1.28155 WP_000106992.1.28170 WP_000106992.1.28174 WP_000106992.1.28198 WP_000106992.1.28200 WP_000106992.1.2822 WP_000106992.1.28225 WP_000106992.1.28229 WP_000106992.1.28232 WP_000106992.1.28233 WP_000106992.1.28235 WP_000106992.1.2825 WP_000106992.1.28267 WP_000106992.1.2829 WP_000106992.1.28301 WP_000106992.1.28302 WP_000106992.1.28303 WP_000106992.1.2835 WP_000106992.1.28370 WP_000106992.1.28384 WP_000106992.1.28386 WP_000106992.1.28393 WP_000106992.1.28395 WP_000106992.1.284 WP_000106992.1.2845 WP_000106992.1.28462 WP_000106992.1.28479 WP_000106992.1.28504 WP_000106992.1.28514 WP_000106992.1.2853 WP_000106992.1.28538 WP_000106992.1.28570 WP_000106992.1.28575 WP_000106992.1.28612 WP_000106992.1.28620 WP_000106992.1.28625 WP_000106992.1.28627 WP_000106992.1.28655 WP_000106992.1.28673 WP_000106992.1.28692 WP_000106992.1.28694 WP_000106992.1.287 WP_000106992.1.2873 WP_000106992.1.28773 WP_000106992.1.28775 WP_000106992.1.28776 WP_000106992.1.2879 WP_000106992.1.28811 WP_000106992.1.28830 WP_000106992.1.2890 WP_000106992.1.28902 WP_000106992.1.28917 WP_000106992.1.28921 WP_000106992.1.28938 WP_000106992.1.28946 WP_000106992.1.28948 WP_000106992.1.28962 WP_000106992.1.28963 WP_000106992.1.28977 WP_000106992.1.29006 WP_000106992.1.29010 WP_000106992.1.29023 WP_000106992.1.29042 WP_000106992.1.2905 WP_000106992.1.2907 WP_000106992.1.29081 WP_000106992.1.29089 WP_000106992.1.29099 WP_000106992.1.2910 WP_000106992.1.29113 WP_000106992.1.29130 WP_000106992.1.29153 WP_000106992.1.29168 WP_000106992.1.29174 WP_000106992.1.29190 WP_000106992.1.29203 WP_000106992.1.29218 WP_000106992.1.29237 WP_000106992.1.2924 WP_000106992.1.29248 WP_000106992.1.29255 WP_000106992.1.29265 WP_000106992.1.29274 WP_000106992.1.29288 WP_000106992.1.2932 WP_000106992.1.29349 WP_000106992.1.29379 WP_000106992.1.29389 WP_000106992.1.29422 WP_000106992.1.29436 WP_000106992.1.29439 WP_000106992.1.29454 WP_000106992.1.2946 WP_000106992.1.29462 WP_000106992.1.29509 WP_000106992.1.29530 WP_000106992.1.29563 WP_000106992.1.29576 WP_000106992.1.29588 WP_000106992.1.29593 WP_000106992.1.29601 WP_000106992.1.29606 WP_000106992.1.29615 WP_000106992.1.29619 WP_000106992.1.29682 WP_000106992.1.29704 WP_000106992.1.29711 WP_000106992.1.29727 WP_000106992.1.29732 WP_000106992.1.29743 WP_000106992.1.29768 WP_000106992.1.29774 WP_000106992.1.29775 WP_000106992.1.29782 WP_000106992.1.29827 WP_000106992.1.29833 WP_000106992.1.2984 WP_000106992.1.29845 WP_000106992.1.29851 WP_000106992.1.29865 WP_000106992.1.29886 WP_000106992.1.29919 WP_000106992.1.29923 WP_000106992.1.29924 WP_000106992.1.2994 WP_000106992.1.29964 WP_000106992.1.29969 WP_000106992.1.29983 WP_000106992.1.29990 WP_000106992.1.30006 WP_000106992.1.30009 WP_000106992.1.30013 WP_000106992.1.3002 WP_000106992.1.30022 WP_000106992.1.30027 WP_000106992.1.30034 WP_000106992.1.30049 WP_000106992.1.3005 WP_000106992.1.30058 WP_000106992.1.30059 WP_000106992.1.30086 WP_000106992.1.30165 WP_000106992.1.3017 WP_000106992.1.30170 WP_000106992.1.30172 WP_000106992.1.30179 WP_000106992.1.30180 WP_000106992.1.30185 WP_000106992.1.30195 WP_000106992.1.30202 WP_000106992.1.30210 WP_000106992.1.30225 WP_000106992.1.30238 WP_000106992.1.30246 WP_000106992.1.30278 WP_000106992.1.30331 WP_000106992.1.30354 WP_000106992.1.30356 WP_000106992.1.30357 WP_000106992.1.30362 WP_000106992.1.30386 WP_000106992.1.30389 WP_000106992.1.3042 WP_000106992.1.30421 WP_000106992.1.30425 WP_000106992.1.30437 WP_000106992.1.30440 WP_000106992.1.30448 WP_000106992.1.30469 WP_000106992.1.30489 WP_000106992.1.30492 WP_000106992.1.30505 WP_000106992.1.30507 WP_000106992.1.30517 WP_000106992.1.30535 WP_000106992.1.30542 WP_000106992.1.30544 WP_000106992.1.30547 WP_000106992.1.30548 WP_000106992.1.30556 WP_000106992.1.30572 WP_000106992.1.30573 WP_000106992.1.30585 WP_000106992.1.30589 WP_000106992.1.30602 WP_000106992.1.30618 WP_000106992.1.30619 WP_000106992.1.30627 WP_000106992.1.30635 WP_000106992.1.3066 WP_000106992.1.30664 WP_000106992.1.3067 WP_000106992.1.3068 WP_000106992.1.30688 WP_000106992.1.30696 WP_000106992.1.30752 WP_000106992.1.3076 WP_000106992.1.30794 WP_000106992.1.3080 WP_000106992.1.30802 WP_000106992.1.30803 WP_000106992.1.30806 WP_000106992.1.30819 WP_000106992.1.30823 WP_000106992.1.30833 WP_000106992.1.30835 WP_000106992.1.3089 WP_000106992.1.30909 WP_000106992.1.30934 WP_000106992.1.3095 WP_000106992.1.30967 WP_000106992.1.30968 WP_000106992.1.30972 WP_000106992.1.31 WP_000106992.1.31001 WP_000106992.1.31011 WP_000106992.1.31046 WP_000106992.1.31066 WP_000106992.1.31078 WP_000106992.1.31086 WP_000106992.1.31092 WP_000106992.1.31107 WP_000106992.1.31111 WP_000106992.1.31122 WP_000106992.1.3113 WP_000106992.1.31139 WP_000106992.1.3114 WP_000106992.1.31145 WP_000106992.1.31155 WP_000106992.1.31156 WP_000106992.1.31167 WP_000106992.1.31171 WP_000106992.1.31182 WP_000106992.1.31185 WP_000106992.1.3119 WP_000106992.1.31190 WP_000106992.1.31195 WP_000106992.1.31196 WP_000106992.1.31198 WP_000106992.1.31205 WP_000106992.1.3121 WP_000106992.1.31210 WP_000106992.1.31214 WP_000106992.1.31222 WP_000106992.1.31223 WP_000106992.1.3124 WP_000106992.1.31251 WP_000106992.1.31262 WP_000106992.1.3127 WP_000106992.1.31272 WP_000106992.1.31281 WP_000106992.1.31303 WP_000106992.1.3131 WP_000106992.1.31335 WP_000106992.1.31352 WP_000106992.1.31362 WP_000106992.1.31389 WP_000106992.1.31413 WP_000106992.1.31435 WP_000106992.1.31446 WP_000106992.1.31451 WP_000106992.1.31476 WP_000106992.1.31504 WP_000106992.1.31533 WP_000106992.1.31578 WP_000106992.1.31585 WP_000106992.1.31658 WP_000106992.1.31665 WP_000106992.1.3167 WP_000106992.1.3170 WP_000106992.1.31720 WP_000106992.1.31725 WP_000106992.1.31762 WP_000106992.1.31782 WP_000106992.1.31799 WP_000106992.1.31836 WP_000106992.1.31845 WP_000106992.1.3185 WP_000106992.1.31854 WP_000106992.1.31895 WP_000106992.1.31901 WP_000106992.1.31927 WP_000106992.1.31940 WP_000106992.1.31951 WP_000106992.1.31952 WP_000106992.1.31967 WP_000106992.1.31972 WP_000106992.1.31983 WP_000106992.1.32006 WP_000106992.1.32038 WP_000106992.1.32041 WP_000106992.1.32042 WP_000106992.1.32054 WP_000106992.1.3207 WP_000106992.1.32109 WP_000106992.1.32116 WP_000106992.1.32170 WP_000106992.1.32189 WP_000106992.1.32192 WP_000106992.1.32202 WP_000106992.1.32204 WP_000106992.1.32206 WP_000106992.1.32252 WP_000106992.1.32260 WP_000106992.1.32263 WP_000106992.1.32274 WP_000106992.1.32275 WP_000106992.1.32277 WP_000106992.1.32293 WP_000106992.1.32299 WP_000106992.1.32309 WP_000106992.1.32357 WP_000106992.1.32368 WP_000106992.1.32408 WP_000106992.1.32422 WP_000106992.1.32423 WP_000106992.1.32424 WP_000106992.1.32425 WP_000106992.1.32434 WP_000106992.1.32438 WP_000106992.1.32458 WP_000106992.1.32459 WP_000106992.1.32460 WP_000106992.1.32491 WP_000106992.1.32515 WP_000106992.1.32519 WP_000106992.1.32527 WP_000106992.1.32529 WP_000106992.1.32545 WP_000106992.1.32563 WP_000106992.1.32578 WP_000106992.1.32617 WP_000106992.1.32624 WP_000106992.1.32629 WP_000106992.1.32660 WP_000106992.1.32668 WP_000106992.1.3270 WP_000106992.1.32702 WP_000106992.1.32714 WP_000106992.1.32725 WP_000106992.1.32740 WP_000106992.1.32747 WP_000106992.1.32750 WP_000106992.1.3278 WP_000106992.1.32786 WP_000106992.1.32804 WP_000106992.1.32832 WP_000106992.1.32838 WP_000106992.1.32848 WP_000106992.1.32868 WP_000106992.1.32881 WP_000106992.1.32899 WP_000106992.1.3290 WP_000106992.1.32900 WP_000106992.1.32902 WP_000106992.1.32907 WP_000106992.1.32930 WP_000106992.1.32940 WP_000106992.1.32941 WP_000106992.1.3296 WP_000106992.1.32961 WP_000106992.1.32966 WP_000106992.1.32977 WP_000106992.1.32985 WP_000106992.1.33010 WP_000106992.1.33030 WP_000106992.1.33037 WP_000106992.1.3304 WP_000106992.1.3305 WP_000106992.1.33051 WP_000106992.1.33065 WP_000106992.1.33078 WP_000106992.1.3310 WP_000106992.1.33106 WP_000106992.1.33114 WP_000106992.1.33122 WP_000106992.1.33127 WP_000106992.1.33143 WP_000106992.1.33144 WP_000106992.1.3315 WP_000106992.1.33160 WP_000106992.1.33208 WP_000106992.1.33214 WP_000106992.1.33247 WP_000106992.1.33248 WP_000106992.1.33253 WP_000106992.1.33261 WP_000106992.1.33270 WP_000106992.1.33280 WP_000106992.1.33283 WP_000106992.1.333 WP_000106992.1.33313 WP_000106992.1.33339 WP_000106992.1.33382 WP_000106992.1.33392 WP_000106992.1.33409 WP_000106992.1.33486 WP_000106992.1.33490 WP_000106992.1.33492 WP_000106992.1.33499 WP_000106992.1.335 WP_000106992.1.33501 WP_000106992.1.33529 WP_000106992.1.33553 WP_000106992.1.3356 WP_000106992.1.33580 WP_000106992.1.33586 WP_000106992.1.33592 WP_000106992.1.33609 WP_000106992.1.33629 WP_000106992.1.3364 WP_000106992.1.33659 WP_000106992.1.33689 WP_000106992.1.33693 WP_000106992.1.3370 WP_000106992.1.33730 WP_000106992.1.33741 WP_000106992.1.33817 WP_000106992.1.33825 WP_000106992.1.33840 WP_000106992.1.33865 WP_000106992.1.33870 WP_000106992.1.33894 WP_000106992.1.3392 WP_000106992.1.33926 WP_000106992.1.3394 WP_000106992.1.33957 WP_000106992.1.3396 WP_000106992.1.33969 WP_000106992.1.33986 WP_000106992.1.34001 WP_000106992.1.34022 WP_000106992.1.34043 WP_000106992.1.34059 WP_000106992.1.34075 WP_000106992.1.34081 WP_000106992.1.34084 WP_000106992.1.34091 WP_000106992.1.34107 WP_000106992.1.34118 WP_000106992.1.34126 WP_000106992.1.34179 WP_000106992.1.34184 WP_000106992.1.34185 WP_000106992.1.34211 WP_000106992.1.34214 WP_000106992.1.34234 WP_000106992.1.34257 WP_000106992.1.34259 WP_000106992.1.34279 WP_000106992.1.34284 WP_000106992.1.34292 WP_000106992.1.34304 WP_000106992.1.34319 WP_000106992.1.34330 WP_000106992.1.34376 WP_000106992.1.3438 WP_000106992.1.34382 WP_000106992.1.34417 WP_000106992.1.34431 WP_000106992.1.3445 WP_000106992.1.34453 WP_000106992.1.34454 WP_000106992.1.34458 WP_000106992.1.34484 WP_000106992.1.34496 WP_000106992.1.34517 WP_000106992.1.34530 WP_000106992.1.34610 WP_000106992.1.34614 WP_000106992.1.34647 WP_000106992.1.34659 WP_000106992.1.34665 WP_000106992.1.34667 WP_000106992.1.34684 WP_000106992.1.34694 WP_000106992.1.34703 WP_000106992.1.34704 WP_000106992.1.34707 WP_000106992.1.34711 WP_000106992.1.34745 WP_000106992.1.34751 WP_000106992.1.3476 WP_000106992.1.34801 WP_000106992.1.34808 WP_000106992.1.34817 WP_000106992.1.34820 WP_000106992.1.34824 WP_000106992.1.34834 WP_000106992.1.34854 WP_000106992.1.34856 WP_000106992.1.34881 WP_000106992.1.3489 WP_000106992.1.34932 WP_000106992.1.34962 WP_000106992.1.34972 WP_000106992.1.34975 WP_000106992.1.35001 WP_000106992.1.35035 WP_000106992.1.35040 WP_000106992.1.35045 WP_000106992.1.35074 WP_000106992.1.35075 WP_000106992.1.35125 WP_000106992.1.35129 WP_000106992.1.35175 WP_000106992.1.35184 WP_000106992.1.35193 WP_000106992.1.35219 WP_000106992.1.35240 WP_000106992.1.35274 WP_000106992.1.35294 WP_000106992.1.35298 WP_000106992.1.35321 WP_000106992.1.35332 WP_000106992.1.35404 WP_000106992.1.35408 WP_000106992.1.3541 WP_000106992.1.35425 WP_000106992.1.35429 WP_000106992.1.35446 WP_000106992.1.35460 WP_000106992.1.35463 WP_000106992.1.35494 WP_000106992.1.35503 WP_000106992.1.35509 WP_000106992.1.35532 WP_000106992.1.3556 WP_000106992.1.35560 WP_000106992.1.35563 WP_000106992.1.3557 WP_000106992.1.35570 WP_000106992.1.35590 WP_000106992.1.35594 WP_000106992.1.35619 WP_000106992.1.35624 WP_000106992.1.35628 WP_000106992.1.35648 WP_000106992.1.3566 WP_000106992.1.3570 WP_000106992.1.35712 WP_000106992.1.35713 WP_000106992.1.3572 WP_000106992.1.35736 WP_000106992.1.35791 WP_000106992.1.35795 WP_000106992.1.35809 WP_000106992.1.35835 WP_000106992.1.35868 WP_000106992.1.35870 WP_000106992.1.35887 WP_000106992.1.35892 WP_000106992.1.35916 WP_000106992.1.35936 WP_000106992.1.35938 WP_000106992.1.35940 WP_000106992.1.35961 WP_000106992.1.35966 WP_000106992.1.35993 WP_000106992.1.36000 WP_000106992.1.36003 WP_000106992.1.3601 WP_000106992.1.36011 WP_000106992.1.36017 WP_000106992.1.36034 WP_000106992.1.36036 WP_000106992.1.36037 WP_000106992.1.36063 WP_000106992.1.36069 WP_000106992.1.3610 WP_000106992.1.36157 WP_000106992.1.36172 WP_000106992.1.36229 WP_000106992.1.36232 WP_000106992.1.36236 WP_000106992.1.36286 WP_000106992.1.36291 WP_000106992.1.36298 WP_000106992.1.36308 WP_000106992.1.36323 WP_000106992.1.36343 WP_000106992.1.36409 WP_000106992.1.36425 WP_000106992.1.36445 WP_000106992.1.36460 WP_000106992.1.3649 WP_000106992.1.36495 WP_000106992.1.36512 WP_000106992.1.36526 WP_000106992.1.36542 WP_000106992.1.36547 WP_000106992.1.36564 WP_000106992.1.36567 WP_000106992.1.36579 WP_000106992.1.36584 WP_000106992.1.36592 WP_000106992.1.36609 WP_000106992.1.36617 WP_000106992.1.36618 WP_000106992.1.36643 WP_000106992.1.36652 WP_000106992.1.36663 WP_000106992.1.36685 WP_000106992.1.36690 WP_000106992.1.3670 WP_000106992.1.36701 WP_000106992.1.36721 WP_000106992.1.36725 WP_000106992.1.36764 WP_000106992.1.36765 WP_000106992.1.36779 WP_000106992.1.36792 WP_000106992.1.36798 WP_000106992.1.36802 WP_000106992.1.36821 WP_000106992.1.36839 WP_000106992.1.36853 WP_000106992.1.3688 WP_000106992.1.36885 WP_000106992.1.36889 WP_000106992.1.36899 WP_000106992.1.36918 WP_000106992.1.36931 WP_000106992.1.36949 WP_000106992.1.36950 WP_000106992.1.36978 WP_000106992.1.37013 WP_000106992.1.37014 WP_000106992.1.37021 WP_000106992.1.37028 WP_000106992.1.37029 WP_000106992.1.37063 WP_000106992.1.37073 WP_000106992.1.37100 WP_000106992.1.37111 WP_000106992.1.37112 WP_000106992.1.37114 WP_000106992.1.37133 WP_000106992.1.37147 WP_000106992.1.37158 WP_000106992.1.37176 WP_000106992.1.37190 WP_000106992.1.37191 WP_000106992.1.37199 WP_000106992.1.37200 WP_000106992.1.37256 WP_000106992.1.37258 WP_000106992.1.3726 WP_000106992.1.37267 WP_000106992.1.3728 WP_000106992.1.37293 WP_000106992.1.37297 WP_000106992.1.37303 WP_000106992.1.37320 WP_000106992.1.3734 WP_000106992.1.37351 WP_000106992.1.37363 WP_000106992.1.37370 WP_000106992.1.37376 WP_000106992.1.37405 WP_000106992.1.3744 WP_000106992.1.37478 WP_000106992.1.3748 WP_000106992.1.37498 WP_000106992.1.37504 WP_000106992.1.3751 WP_000106992.1.37513 WP_000106992.1.37521 WP_000106992.1.37558 WP_000106992.1.3756 WP_000106992.1.37584 WP_000106992.1.37590 WP_000106992.1.37593 WP_000106992.1.37600 WP_000106992.1.37610 WP_000106992.1.37613 WP_000106992.1.37618 WP_000106992.1.37659 WP_000106992.1.37662 WP_000106992.1.37666 WP_000106992.1.37675 WP_000106992.1.37691 WP_000106992.1.3771 WP_000106992.1.37719 WP_000106992.1.37761 WP_000106992.1.37775 WP_000106992.1.37777 WP_000106992.1.3778 WP_000106992.1.378 WP_000106992.1.37808 WP_000106992.1.37848 WP_000106992.1.37864 WP_000106992.1.379 WP_000106992.1.3790 WP_000106992.1.37911 WP_000106992.1.37941 WP_000106992.1.37965 WP_000106992.1.37968 WP_000106992.1.37978 WP_000106992.1.37985 WP_000106992.1.38001 WP_000106992.1.38026 WP_000106992.1.38037 WP_000106992.1.38047 WP_000106992.1.38055 WP_000106992.1.38061 WP_000106992.1.38064 WP_000106992.1.38108 WP_000106992.1.38113 WP_000106992.1.38125 WP_000106992.1.38145 WP_000106992.1.3816 WP_000106992.1.38199 WP_000106992.1.38207 WP_000106992.1.38261 WP_000106992.1.38266 WP_000106992.1.38273 WP_000106992.1.3828 WP_000106992.1.383 WP_000106992.1.38310 WP_000106992.1.38322 WP_000106992.1.3834 WP_000106992.1.38341 WP_000106992.1.38344 WP_000106992.1.38349 WP_000106992.1.38351 WP_000106992.1.3838 WP_000106992.1.38381 WP_000106992.1.38393 WP_000106992.1.38408 WP_000106992.1.38440 WP_000106992.1.3848 WP_000106992.1.38486 WP_000106992.1.38512 WP_000106992.1.38515 WP_000106992.1.38569 WP_000106992.1.38595 WP_000106992.1.3860 WP_000106992.1.38609 WP_000106992.1.38613 WP_000106992.1.38622 WP_000106992.1.38642 WP_000106992.1.38673 WP_000106992.1.38693 WP_000106992.1.38734 WP_000106992.1.38740 WP_000106992.1.38773 WP_000106992.1.38781 WP_000106992.1.38797 WP_000106992.1.38830 WP_000106992.1.38857 WP_000106992.1.38877 WP_000106992.1.38881 WP_000106992.1.38882 WP_000106992.1.38895 WP_000106992.1.38898 WP_000106992.1.3891 WP_000106992.1.38942 WP_000106992.1.38983 WP_000106992.1.38995 WP_000106992.1.38996 WP_000106992.1.39003 WP_000106992.1.39038 WP_000106992.1.39048 WP_000106992.1.39055 WP_000106992.1.39056 WP_000106992.1.39059 WP_000106992.1.39065 WP_000106992.1.3907 WP_000106992.1.39075 WP_000106992.1.39082 WP_000106992.1.39105 WP_000106992.1.39113 WP_000106992.1.39128 WP_000106992.1.39136 WP_000106992.1.3914 WP_000106992.1.39140 WP_000106992.1.39146 WP_000106992.1.39147 WP_000106992.1.39161 WP_000106992.1.39183 WP_000106992.1.39197 WP_000106992.1.39210 WP_000106992.1.39229 WP_000106992.1.39235 WP_000106992.1.39265 WP_000106992.1.39275 WP_000106992.1.3931 WP_000106992.1.39311 WP_000106992.1.39312 WP_000106992.1.39385 WP_000106992.1.39395 WP_000106992.1.39405 WP_000106992.1.39414 WP_000106992.1.39435 WP_000106992.1.39449 WP_000106992.1.39466 WP_000106992.1.39471 WP_000106992.1.39497 WP_000106992.1.39502 WP_000106992.1.39503 WP_000106992.1.39512 WP_000106992.1.39530 WP_000106992.1.39553 WP_000106992.1.39584 WP_000106992.1.39609 WP_000106992.1.39614 WP_000106992.1.39619 WP_000106992.1.39620 WP_000106992.1.39624 WP_000106992.1.39629 WP_000106992.1.39632 WP_000106992.1.39659 WP_000106992.1.39667 WP_000106992.1.39722 WP_000106992.1.39723 WP_000106992.1.39724 WP_000106992.1.39763 WP_000106992.1.39775 WP_000106992.1.39808 WP_000106992.1.39862 WP_000106992.1.39879 WP_000106992.1.39890 WP_000106992.1.39921 WP_000106992.1.39941 WP_000106992.1.39945 WP_000106992.1.39947 WP_000106992.1.40008 WP_000106992.1.40017 WP_000106992.1.40025 WP_000106992.1.40072 WP_000106992.1.40073 WP_000106992.1.40081 WP_000106992.1.40095 WP_000106992.1.40097 WP_000106992.1.401 WP_000106992.1.4011 WP_000106992.1.40111 WP_000106992.1.40155 WP_000106992.1.40158 WP_000106992.1.40160 WP_000106992.1.40167 WP_000106992.1.40171 WP_000106992.1.40205 WP_000106992.1.40208 WP_000106992.1.40224 WP_000106992.1.40229 WP_000106992.1.40240 WP_000106992.1.40254 WP_000106992.1.40257 WP_000106992.1.40258 WP_000106992.1.40259 WP_000106992.1.40279 WP_000106992.1.40284 WP_000106992.1.40292 WP_000106992.1.40305 WP_000106992.1.40307 WP_000106992.1.40311 WP_000106992.1.40341 WP_000106992.1.40361 WP_000106992.1.40374 WP_000106992.1.40380 WP_000106992.1.40395 WP_000106992.1.4042 WP_000106992.1.40465 WP_000106992.1.40467 WP_000106992.1.40492 WP_000106992.1.40493 WP_000106992.1.40496 WP_000106992.1.40508 WP_000106992.1.40517 WP_000106992.1.40528 WP_000106992.1.40533 WP_000106992.1.40577 WP_000106992.1.40583 WP_000106992.1.40605 WP_000106992.1.40622 WP_000106992.1.40648 WP_000106992.1.40693 WP_000106992.1.40695 WP_000106992.1.40698 WP_000106992.1.40710 WP_000106992.1.40722 WP_000106992.1.40745 WP_000106992.1.4075 WP_000106992.1.40750 WP_000106992.1.40763 WP_000106992.1.40771 WP_000106992.1.40788 WP_000106992.1.40849 WP_000106992.1.40854 WP_000106992.1.4087 WP_000106992.1.40877 WP_000106992.1.4088 WP_000106992.1.4089 WP_000106992.1.40910 WP_000106992.1.40924 WP_000106992.1.40930 WP_000106992.1.40932 WP_000106992.1.40935 WP_000106992.1.40946 WP_000106992.1.40973 WP_000106992.1.40979 WP_000106992.1.40996 WP_000106992.1.41004 WP_000106992.1.41017 WP_000106992.1.41018 WP_000106992.1.41048 WP_000106992.1.41050 WP_000106992.1.4106 WP_000106992.1.41070 WP_000106992.1.41074 WP_000106992.1.41075 WP_000106992.1.41086 WP_000106992.1.4109 WP_000106992.1.41091 WP_000106992.1.41097 WP_000106992.1.41116 WP_000106992.1.41128 WP_000106992.1.41132 WP_000106992.1.41176 WP_000106992.1.41192 WP_000106992.1.41225 WP_000106992.1.41226 WP_000106992.1.41251 WP_000106992.1.41258 WP_000106992.1.41265 WP_000106992.1.41277 WP_000106992.1.41279 WP_000106992.1.41299 WP_000106992.1.41305 WP_000106992.1.41308 WP_000106992.1.41310 WP_000106992.1.41321 WP_000106992.1.41333 WP_000106992.1.41335 WP_000106992.1.41345 WP_000106992.1.4136 WP_000106992.1.41375 WP_000106992.1.4141 WP_000106992.1.41415 WP_000106992.1.41427 WP_000106992.1.41434 WP_000106992.1.41438 WP_000106992.1.41440 WP_000106992.1.41459 WP_000106992.1.41468 WP_000106992.1.41498 WP_000106992.1.41516 WP_000106992.1.41519 WP_000106992.1.41524 WP_000106992.1.41528 WP_000106992.1.41554 WP_000106992.1.41572 WP_000106992.1.41591 WP_000106992.1.41593 WP_000106992.1.41610 WP_000106992.1.41628 WP_000106992.1.41631 WP_000106992.1.41658 WP_000106992.1.41659 WP_000106992.1.41662 WP_000106992.1.41688 WP_000106992.1.41690 WP_000106992.1.41708 WP_000106992.1.41716 WP_000106992.1.41724 WP_000106992.1.41735 WP_000106992.1.41746 WP_000106992.1.41761 WP_000106992.1.4178 WP_000106992.1.41789 WP_000106992.1.41799 WP_000106992.1.41802 WP_000106992.1.41824 WP_000106992.1.41825 WP_000106992.1.41836 WP_000106992.1.4184 WP_000106992.1.41862 WP_000106992.1.41877 WP_000106992.1.41882 WP_000106992.1.41894 WP_000106992.1.41897 WP_000106992.1.41904 WP_000106992.1.41911 WP_000106992.1.41919 WP_000106992.1.41929 WP_000106992.1.41931 WP_000106992.1.41938 WP_000106992.1.4194 WP_000106992.1.41949 WP_000106992.1.41978 WP_000106992.1.41979 WP_000106992.1.41985 WP_000106992.1.41994 WP_000106992.1.41998 WP_000106992.1.42009 WP_000106992.1.42069 WP_000106992.1.42081 WP_000106992.1.42090 WP_000106992.1.42104 WP_000106992.1.42109 WP_000106992.1.42111 WP_000106992.1.42136 WP_000106992.1.42156 WP_000106992.1.42187 WP_000106992.1.422 WP_000106992.1.42200 WP_000106992.1.42219 WP_000106992.1.4222 WP_000106992.1.42238 WP_000106992.1.42243 WP_000106992.1.42244 WP_000106992.1.42248 WP_000106992.1.42257 WP_000106992.1.42261 WP_000106992.1.42262 WP_000106992.1.42263 WP_000106992.1.42276 WP_000106992.1.42320 WP_000106992.1.42322 WP_000106992.1.42328 WP_000106992.1.42342 WP_000106992.1.42349 WP_000106992.1.42356 WP_000106992.1.42364 WP_000106992.1.42371 WP_000106992.1.42379 WP_000106992.1.4239 WP_000106992.1.42391 WP_000106992.1.42392 WP_000106992.1.42399 WP_000106992.1.42404 WP_000106992.1.42422 WP_000106992.1.42433 WP_000106992.1.42444 WP_000106992.1.42453 WP_000106992.1.42491 WP_000106992.1.42539 WP_000106992.1.4257 WP_000106992.1.42595 WP_000106992.1.42603 WP_000106992.1.42605 WP_000106992.1.42650 WP_000106992.1.42655 WP_000106992.1.42666 WP_000106992.1.4267 WP_000106992.1.42675 WP_000106992.1.42676 WP_000106992.1.42683 WP_000106992.1.42685 WP_000106992.1.42701 WP_000106992.1.42707 WP_000106992.1.42734 WP_000106992.1.4276 WP_000106992.1.42767 WP_000106992.1.42794 WP_000106992.1.42797 WP_000106992.1.42805 WP_000106992.1.42815 WP_000106992.1.42829 WP_000106992.1.42859 WP_000106992.1.42861 WP_000106992.1.42864 WP_000106992.1.4288 WP_000106992.1.42887 WP_000106992.1.4289 WP_000106992.1.42892 WP_000106992.1.42923 WP_000106992.1.42932 WP_000106992.1.42957 WP_000106992.1.42978 WP_000106992.1.4298 WP_000106992.1.42981 WP_000106992.1.43008 WP_000106992.1.43016 WP_000106992.1.43018 WP_000106992.1.43019 WP_000106992.1.43041 WP_000106992.1.43065 WP_000106992.1.43068 WP_000106992.1.43069 WP_000106992.1.43077 WP_000106992.1.43086 WP_000106992.1.43089 WP_000106992.1.43126 WP_000106992.1.43128 WP_000106992.1.43141 WP_000106992.1.43149 WP_000106992.1.43157 WP_000106992.1.43160 WP_000106992.1.43161 WP_000106992.1.43190 WP_000106992.1.43198 WP_000106992.1.43201 WP_000106992.1.43244 WP_000106992.1.43258 WP_000106992.1.4326 WP_000106992.1.43272 WP_000106992.1.43276 WP_000106992.1.43290 WP_000106992.1.43292 WP_000106992.1.43299 WP_000106992.1.43307 WP_000106992.1.43312 WP_000106992.1.4332 WP_000106992.1.43334 WP_000106992.1.43339 WP_000106992.1.43371 WP_000106992.1.43437 WP_000106992.1.43438 WP_000106992.1.4344 WP_000106992.1.43441 WP_000106992.1.43476 WP_000106992.1.43508 WP_000106992.1.43513 WP_000106992.1.43520 WP_000106992.1.43522 WP_000106992.1.43528 WP_000106992.1.43535 WP_000106992.1.43606 WP_000106992.1.43613 WP_000106992.1.43633 WP_000106992.1.43637 WP_000106992.1.43651 WP_000106992.1.43654 WP_000106992.1.43668 WP_000106992.1.43676 WP_000106992.1.43685 WP_000106992.1.43710 WP_000106992.1.43711 WP_000106992.1.43722 WP_000106992.1.4373 WP_000106992.1.43778 WP_000106992.1.43782 WP_000106992.1.43785 WP_000106992.1.43801 WP_000106992.1.43812 WP_000106992.1.43828 WP_000106992.1.43839 WP_000106992.1.43864 WP_000106992.1.43873 WP_000106992.1.43875 WP_000106992.1.43878 WP_000106992.1.43886 WP_000106992.1.43888 WP_000106992.1.43919 WP_000106992.1.43951 WP_000106992.1.43954 WP_000106992.1.43974 WP_000106992.1.44005 WP_000106992.1.44010 WP_000106992.1.4404 WP_000106992.1.44043 WP_000106992.1.44049 WP_000106992.1.4405 WP_000106992.1.44063 WP_000106992.1.44099 WP_000106992.1.44101 WP_000106992.1.44121 WP_000106992.1.44160 WP_000106992.1.44180 WP_000106992.1.44187 WP_000106992.1.44191 WP_000106992.1.44196 WP_000106992.1.4422 WP_000106992.1.4423 WP_000106992.1.44248 WP_000106992.1.44250 WP_000106992.1.44262 WP_000106992.1.44268 WP_000106992.1.4427 WP_000106992.1.44291 WP_000106992.1.44296 WP_000106992.1.44300 WP_000106992.1.44310 WP_000106992.1.44337 WP_000106992.1.44339 WP_000106992.1.44343 WP_000106992.1.44351 WP_000106992.1.44359 WP_000106992.1.44360 WP_000106992.1.44380 WP_000106992.1.44386 WP_000106992.1.44397 WP_000106992.1.4440 WP_000106992.1.44416 WP_000106992.1.44431 WP_000106992.1.44433 WP_000106992.1.44437 WP_000106992.1.44438 WP_000106992.1.44440 WP_000106992.1.44443 WP_000106992.1.44453 WP_000106992.1.44474 WP_000106992.1.44546 WP_000106992.1.44549 WP_000106992.1.44578 WP_000106992.1.44593 WP_000106992.1.44607 WP_000106992.1.44633 WP_000106992.1.44636 WP_000106992.1.44640 WP_000106992.1.4467 WP_000106992.1.44678 WP_000106992.1.4468 WP_000106992.1.44702 WP_000106992.1.44705 WP_000106992.1.44747 WP_000106992.1.44762 WP_000106992.1.44781 WP_000106992.1.44791 WP_000106992.1.44795 WP_000106992.1.44815 WP_000106992.1.44828 WP_000106992.1.44831 WP_000106992.1.44833 WP_000106992.1.4485 WP_000106992.1.44877 WP_000106992.1.44879 WP_000106992.1.44887 WP_000106992.1.449 WP_000106992.1.44917 WP_000106992.1.44927 WP_000106992.1.44933 WP_000106992.1.44950 WP_000106992.1.44966 WP_000106992.1.44978 WP_000106992.1.44996 WP_000106992.1.44997 WP_000106992.1.44998 WP_000106992.1.4500 WP_000106992.1.4501 WP_000106992.1.45027 WP_000106992.1.45038 WP_000106992.1.45067 WP_000106992.1.45072 WP_000106992.1.45074 WP_000106992.1.45079 WP_000106992.1.45093 WP_000106992.1.45098 WP_000106992.1.45123 WP_000106992.1.45134 WP_000106992.1.45136 WP_000106992.1.45138 WP_000106992.1.45145 WP_000106992.1.45154 WP_000106992.1.45173 WP_000106992.1.45177 WP_000106992.1.45184 WP_000106992.1.45229 WP_000106992.1.45241 WP_000106992.1.45251 WP_000106992.1.45259 WP_000106992.1.45268 WP_000106992.1.45302 WP_000106992.1.4531 WP_000106992.1.45322 WP_000106992.1.45344 WP_000106992.1.45349 WP_000106992.1.45351 WP_000106992.1.45365 WP_000106992.1.4540 WP_000106992.1.45402 WP_000106992.1.45432 WP_000106992.1.45434 WP_000106992.1.45435 WP_000106992.1.45462 WP_000106992.1.45468 WP_000106992.1.45522 WP_000106992.1.45523 WP_000106992.1.45535 WP_000106992.1.45544 WP_000106992.1.45549 WP_000106992.1.45550 WP_000106992.1.45566 WP_000106992.1.45569 WP_000106992.1.45571 WP_000106992.1.45582 WP_000106992.1.45583 WP_000106992.1.45585 WP_000106992.1.45596 WP_000106992.1.45622 WP_000106992.1.45648 WP_000106992.1.45660 WP_000106992.1.45690 WP_000106992.1.45781 WP_000106992.1.458 WP_000106992.1.45829 WP_000106992.1.45844 WP_000106992.1.45848 WP_000106992.1.45871 WP_000106992.1.45906 WP_000106992.1.45918 WP_000106992.1.4592 WP_000106992.1.45984 WP_000106992.1.46011 WP_000106992.1.46028 WP_000106992.1.46030 WP_000106992.1.46069 WP_000106992.1.46077 WP_000106992.1.46091 WP_000106992.1.46112 WP_000106992.1.46124 WP_000106992.1.46169 WP_000106992.1.46174 WP_000106992.1.46187 WP_000106992.1.46203 WP_000106992.1.46205 WP_000106992.1.46215 WP_000106992.1.46225 WP_000106992.1.46232 WP_000106992.1.46241 WP_000106992.1.46243 WP_000106992.1.46250 WP_000106992.1.46278 WP_000106992.1.46286 WP_000106992.1.46299 WP_000106992.1.46307 WP_000106992.1.46322 WP_000106992.1.46323 WP_000106992.1.46345 WP_000106992.1.46355 WP_000106992.1.46358 WP_000106992.1.464 WP_000106992.1.46406 WP_000106992.1.46434 WP_000106992.1.46444 WP_000106992.1.46454 WP_000106992.1.46461 WP_000106992.1.46499 WP_000106992.1.46504 WP_000106992.1.46505 WP_000106992.1.46551 WP_000106992.1.46559 WP_000106992.1.46572 WP_000106992.1.46574 WP_000106992.1.46578 WP_000106992.1.46595 WP_000106992.1.46620 WP_000106992.1.46637 WP_000106992.1.46666 WP_000106992.1.46675 WP_000106992.1.46689 WP_000106992.1.46693 WP_000106992.1.46701 WP_000106992.1.4671 WP_000106992.1.46726 WP_000106992.1.46730 WP_000106992.1.46732 WP_000106992.1.4674 WP_000106992.1.46749 WP_000106992.1.46781 WP_000106992.1.46803 WP_000106992.1.46804 WP_000106992.1.46816 WP_000106992.1.46842 WP_000106992.1.4686 WP_000106992.1.4690 WP_000106992.1.46920 WP_000106992.1.46930 WP_000106992.1.46945 WP_000106992.1.46961 WP_000106992.1.46967 WP_000106992.1.46976 WP_000106992.1.47008 WP_000106992.1.47014 WP_000106992.1.47036 WP_000106992.1.47037 WP_000106992.1.47042 WP_000106992.1.47057 WP_000106992.1.47058 WP_000106992.1.47059 WP_000106992.1.47067 WP_000106992.1.47085 WP_000106992.1.47123 WP_000106992.1.47214 WP_000106992.1.47215 WP_000106992.1.47245 WP_000106992.1.47257 WP_000106992.1.47389 WP_000106992.1.47429 WP_000106992.1.47442 WP_000106992.1.47448 WP_000106992.1.47460 WP_000106992.1.4747 WP_000106992.1.47472 WP_000106992.1.47478 WP_000106992.1.47482 WP_000106992.1.47492 WP_000106992.1.47506 WP_000106992.1.47507 WP_000106992.1.47523 WP_000106992.1.47531 WP_000106992.1.47532 WP_000106992.1.47567 WP_000106992.1.47576 WP_000106992.1.47579 WP_000106992.1.4758 WP_000106992.1.47587 WP_000106992.1.47605 WP_000106992.1.47614 WP_000106992.1.47621 WP_000106992.1.47630 WP_000106992.1.47649 WP_000106992.1.4769 WP_000106992.1.4770 WP_000106992.1.47714 WP_000106992.1.4774 WP_000106992.1.4775 WP_000106992.1.47756 WP_000106992.1.47767 WP_000106992.1.47799 WP_000106992.1.4781 WP_000106992.1.47814 WP_000106992.1.47817 WP_000106992.1.47829 WP_000106992.1.47849 WP_000106992.1.47850 WP_000106992.1.47875 WP_000106992.1.47886 WP_000106992.1.47898 WP_000106992.1.47902 WP_000106992.1.47911 WP_000106992.1.47928 WP_000106992.1.4795 WP_000106992.1.47988 WP_000106992.1.47992 WP_000106992.1.48019 WP_000106992.1.48100 WP_000106992.1.48114 WP_000106992.1.48124 WP_000106992.1.48132 WP_000106992.1.48139 WP_000106992.1.48190 WP_000106992.1.48209 WP_000106992.1.48215 WP_000106992.1.48218 WP_000106992.1.48242 WP_000106992.1.48244 WP_000106992.1.48247 WP_000106992.1.48253 WP_000106992.1.48262 WP_000106992.1.48268 WP_000106992.1.48292 WP_000106992.1.483 WP_000106992.1.48324 WP_000106992.1.48367 WP_000106992.1.48377 WP_000106992.1.4839 WP_000106992.1.48399 WP_000106992.1.48426 WP_000106992.1.48430 WP_000106992.1.48436 WP_000106992.1.48455 WP_000106992.1.48493 WP_000106992.1.48524 WP_000106992.1.4853 WP_000106992.1.48570 WP_000106992.1.48586 WP_000106992.1.4859 WP_000106992.1.48591 WP_000106992.1.48610 WP_000106992.1.48631 WP_000106992.1.48647 WP_000106992.1.48663 WP_000106992.1.48690 WP_000106992.1.48734 WP_000106992.1.48755 WP_000106992.1.48756 WP_000106992.1.48774 WP_000106992.1.48778 WP_000106992.1.48788 WP_000106992.1.48797 WP_000106992.1.48849 WP_000106992.1.4885 WP_000106992.1.48855 WP_000106992.1.48876 WP_000106992.1.48886 WP_000106992.1.48894 WP_000106992.1.48896 WP_000106992.1.48908 WP_000106992.1.48918 WP_000106992.1.48919 WP_000106992.1.48931 WP_000106992.1.48955 WP_000106992.1.48963 WP_000106992.1.48973 WP_000106992.1.48985 WP_000106992.1.49004 WP_000106992.1.49005 WP_000106992.1.49012 WP_000106992.1.49084 WP_000106992.1.49090 WP_000106992.1.49102 WP_000106992.1.49106 WP_000106992.1.49113 WP_000106992.1.49117 WP_000106992.1.49121 WP_000106992.1.4914 WP_000106992.1.49140 WP_000106992.1.49153 WP_000106992.1.49155 WP_000106992.1.49162 WP_000106992.1.49166 WP_000106992.1.49175 WP_000106992.1.49204 WP_000106992.1.49214 WP_000106992.1.49226 WP_000106992.1.49239 WP_000106992.1.49256 WP_000106992.1.49262 WP_000106992.1.49276 WP_000106992.1.49290 WP_000106992.1.49304 WP_000106992.1.49309 WP_000106992.1.49311 WP_000106992.1.49334 WP_000106992.1.49340 WP_000106992.1.49355 WP_000106992.1.49358 WP_000106992.1.49366 WP_000106992.1.49375 WP_000106992.1.49429 WP_000106992.1.49434 WP_000106992.1.49443 WP_000106992.1.49450 WP_000106992.1.49472 WP_000106992.1.49490 WP_000106992.1.495 WP_000106992.1.49515 WP_000106992.1.49545 WP_000106992.1.49550 WP_000106992.1.49572 WP_000106992.1.49574 WP_000106992.1.49590 WP_000106992.1.49595 WP_000106992.1.49602 WP_000106992.1.49626 WP_000106992.1.49630 WP_000106992.1.49650 WP_000106992.1.49686 WP_000106992.1.49703 WP_000106992.1.49769 WP_000106992.1.49770 WP_000106992.1.49778 WP_000106992.1.49780 WP_000106992.1.4979 WP_000106992.1.49803 WP_000106992.1.49805 WP_000106992.1.49827 WP_000106992.1.49846 WP_000106992.1.49848 WP_000106992.1.4991 WP_000106992.1.49929 WP_000106992.1.49931 WP_000106992.1.49947 WP_000106992.1.49959 WP_000106992.1.49997 WP_000106992.1.50 WP_000106992.1.50003 WP_000106992.1.50007 WP_000106992.1.50014 WP_000106992.1.50030 WP_000106992.1.50043 WP_000106992.1.5009 WP_000106992.1.50103 WP_000106992.1.50128 WP_000106992.1.50158 WP_000106992.1.50161 WP_000106992.1.50198 WP_000106992.1.50211 WP_000106992.1.50238 WP_000106992.1.50239 WP_000106992.1.50247 WP_000106992.1.50251 WP_000106992.1.50285 WP_000106992.1.50308 WP_000106992.1.50309 WP_000106992.1.50332 WP_000106992.1.50349 WP_000106992.1.50374 WP_000106992.1.50376 WP_000106992.1.50386 WP_000106992.1.50387 WP_000106992.1.50389 WP_000106992.1.50404 WP_000106992.1.50406 WP_000106992.1.50413 WP_000106992.1.50449 WP_000106992.1.50468 WP_000106992.1.50478 WP_000106992.1.50480 WP_000106992.1.5051 WP_000106992.1.50517 WP_000106992.1.50563 WP_000106992.1.50565 WP_000106992.1.50566 WP_000106992.1.50570 WP_000106992.1.5058 WP_000106992.1.50593 WP_000106992.1.50626 WP_000106992.1.50652 WP_000106992.1.50676 WP_000106992.1.50684 WP_000106992.1.50726 WP_000106992.1.50769 WP_000106992.1.50771 WP_000106992.1.50774 WP_000106992.1.50800 WP_000106992.1.50804 WP_000106992.1.50808 WP_000106992.1.50811 WP_000106992.1.50875 WP_000106992.1.5088 WP_000106992.1.50882 WP_000106992.1.50885 WP_000106992.1.50893 WP_000106992.1.509 WP_000106992.1.50905 WP_000106992.1.50908 WP_000106992.1.50918 WP_000106992.1.50929 WP_000106992.1.50941 WP_000106992.1.50954 WP_000106992.1.50960 WP_000106992.1.50970 WP_000106992.1.50999 WP_000106992.1.51014 WP_000106992.1.51022 WP_000106992.1.51036 WP_000106992.1.51040 WP_000106992.1.51048 WP_000106992.1.51066 WP_000106992.1.51100 WP_000106992.1.51117 WP_000106992.1.51131 WP_000106992.1.51134 WP_000106992.1.51139 WP_000106992.1.5114 WP_000106992.1.51178 WP_000106992.1.51179 WP_000106992.1.51182 WP_000106992.1.51186 WP_000106992.1.51224 WP_000106992.1.51227 WP_000106992.1.5125 WP_000106992.1.5127 WP_000106992.1.51285 WP_000106992.1.51305 WP_000106992.1.51308 WP_000106992.1.51315 WP_000106992.1.51331 WP_000106992.1.51338 WP_000106992.1.51356 WP_000106992.1.5136 WP_000106992.1.5138 WP_000106992.1.51394 WP_000106992.1.51412 WP_000106992.1.51419 WP_000106992.1.51451 WP_000106992.1.51464 WP_000106992.1.51474 WP_000106992.1.51487 WP_000106992.1.51488 WP_000106992.1.51502 WP_000106992.1.51506 WP_000106992.1.51514 WP_000106992.1.51518 WP_000106992.1.51519 WP_000106992.1.51555 WP_000106992.1.51594 WP_000106992.1.51598 WP_000106992.1.51611 WP_000106992.1.51613 WP_000106992.1.51615 WP_000106992.1.51634 WP_000106992.1.51642 WP_000106992.1.51644 WP_000106992.1.51649 WP_000106992.1.51686 WP_000106992.1.51700 WP_000106992.1.51704 WP_000106992.1.51724 WP_000106992.1.51734 WP_000106992.1.51756 WP_000106992.1.51764 WP_000106992.1.51810 WP_000106992.1.51831 WP_000106992.1.51838 WP_000106992.1.51841 WP_000106992.1.51863 WP_000106992.1.51868 WP_000106992.1.51888 WP_000106992.1.51910 WP_000106992.1.51911 WP_000106992.1.51914 WP_000106992.1.51930 WP_000106992.1.51932 WP_000106992.1.51935 WP_000106992.1.51989 WP_000106992.1.51994 WP_000106992.1.520 WP_000106992.1.52047 WP_000106992.1.52057 WP_000106992.1.5211 WP_000106992.1.52114 WP_000106992.1.52121 WP_000106992.1.52123 WP_000106992.1.52129 WP_000106992.1.52156 WP_000106992.1.5216 WP_000106992.1.52161 WP_000106992.1.52170 WP_000106992.1.52191 WP_000106992.1.52202 WP_000106992.1.52209 WP_000106992.1.52255 WP_000106992.1.52301 WP_000106992.1.52321 WP_000106992.1.52336 WP_000106992.1.52339 WP_000106992.1.52346 WP_000106992.1.52353 WP_000106992.1.52356 WP_000106992.1.52361 WP_000106992.1.52438 WP_000106992.1.52446 WP_000106992.1.52456 WP_000106992.1.52469 WP_000106992.1.52527 WP_000106992.1.52528 WP_000106992.1.52571 WP_000106992.1.52582 WP_000106992.1.52586 WP_000106992.1.526 WP_000106992.1.52608 WP_000106992.1.52637 WP_000106992.1.52647 WP_000106992.1.52653 WP_000106992.1.52656 WP_000106992.1.52675 WP_000106992.1.52692 WP_000106992.1.5273 WP_000106992.1.52738 WP_000106992.1.52742 WP_000106992.1.52743 WP_000106992.1.52744 WP_000106992.1.52748 WP_000106992.1.52773 WP_000106992.1.52795 WP_000106992.1.52807 WP_000106992.1.52833 WP_000106992.1.52851 WP_000106992.1.52857 WP_000106992.1.52858 WP_000106992.1.52866 WP_000106992.1.52887 WP_000106992.1.52898 WP_000106992.1.52915 WP_000106992.1.52924 WP_000106992.1.52949 WP_000106992.1.52985 WP_000106992.1.5301 WP_000106992.1.53092 WP_000106992.1.53100 WP_000106992.1.53107 WP_000106992.1.53119 WP_000106992.1.5313 WP_000106992.1.53141 WP_000106992.1.53151 WP_000106992.1.53154 WP_000106992.1.53158 WP_000106992.1.53159 WP_000106992.1.5316 WP_000106992.1.53179 WP_000106992.1.53190 WP_000106992.1.53198 WP_000106992.1.53203 WP_000106992.1.53210 WP_000106992.1.53233 WP_000106992.1.53234 WP_000106992.1.53272 WP_000106992.1.53274 WP_000106992.1.53307 WP_000106992.1.53315 WP_000106992.1.53316 WP_000106992.1.53321 WP_000106992.1.53328 WP_000106992.1.5333 WP_000106992.1.53362 WP_000106992.1.53368 WP_000106992.1.53375 WP_000106992.1.53385 WP_000106992.1.53406 WP_000106992.1.53450 WP_000106992.1.53454 WP_000106992.1.53466 WP_000106992.1.5349 WP_000106992.1.53529 WP_000106992.1.53534 WP_000106992.1.53540 WP_000106992.1.53543 WP_000106992.1.53555 WP_000106992.1.53559 WP_000106992.1.5356 WP_000106992.1.53567 WP_000106992.1.53571 WP_000106992.1.5358 WP_000106992.1.53664 WP_000106992.1.53675 WP_000106992.1.53688 WP_000106992.1.53692 WP_000106992.1.53694 WP_000106992.1.53696 WP_000106992.1.53723 WP_000106992.1.5374 WP_000106992.1.53750 WP_000106992.1.53757 WP_000106992.1.53772 WP_000106992.1.53778 WP_000106992.1.53781 WP_000106992.1.53790 WP_000106992.1.53800 WP_000106992.1.53812 WP_000106992.1.53814 WP_000106992.1.53815 WP_000106992.1.53839 WP_000106992.1.53892 WP_000106992.1.53896 WP_000106992.1.53898 WP_000106992.1.53902 WP_000106992.1.53905 WP_000106992.1.5392 WP_000106992.1.53935 WP_000106992.1.53958 WP_000106992.1.53961 WP_000106992.1.53981 WP_000106992.1.53984 WP_000106992.1.54033 WP_000106992.1.54061 WP_000106992.1.54068 WP_000106992.1.54075 WP_000106992.1.54082 WP_000106992.1.54085 WP_000106992.1.54132 WP_000106992.1.5415 WP_000106992.1.54159 WP_000106992.1.54170 WP_000106992.1.54175 WP_000106992.1.54196 WP_000106992.1.54203 WP_000106992.1.54209 WP_000106992.1.54259 WP_000106992.1.54271 WP_000106992.1.54274 WP_000106992.1.54283 WP_000106992.1.5430 WP_000106992.1.54319 WP_000106992.1.54324 WP_000106992.1.54333 WP_000106992.1.54364 WP_000106992.1.54366 WP_000106992.1.54371 WP_000106992.1.54400 WP_000106992.1.54431 WP_000106992.1.54442 WP_000106992.1.54469 WP_000106992.1.54482 WP_000106992.1.54500 WP_000106992.1.54522 WP_000106992.1.54526 WP_000106992.1.54558 WP_000106992.1.5456 WP_000106992.1.54569 WP_000106992.1.54589 WP_000106992.1.54607 WP_000106992.1.54615 WP_000106992.1.54644 WP_000106992.1.54662 WP_000106992.1.54667 WP_000106992.1.54678 WP_000106992.1.54681 WP_000106992.1.54694 WP_000106992.1.54722 WP_000106992.1.54748 WP_000106992.1.54749 WP_000106992.1.54764 WP_000106992.1.54774 WP_000106992.1.5481 WP_000106992.1.54814 WP_000106992.1.54822 WP_000106992.1.54827 WP_000106992.1.54833 WP_000106992.1.54845 WP_000106992.1.5485 WP_000106992.1.54865 WP_000106992.1.54877 WP_000106992.1.5493 WP_000106992.1.54935 WP_000106992.1.54936 WP_000106992.1.54979 WP_000106992.1.54984 WP_000106992.1.54992 WP_000106992.1.55008 WP_000106992.1.55010 WP_000106992.1.55034 WP_000106992.1.55073 WP_000106992.1.55152 WP_000106992.1.55156 WP_000106992.1.55163 WP_000106992.1.55165 WP_000106992.1.55166 WP_000106992.1.5517 WP_000106992.1.55178 WP_000106992.1.55215 WP_000106992.1.55223 WP_000106992.1.55224 WP_000106992.1.5523 WP_000106992.1.5525 WP_000106992.1.55285 WP_000106992.1.55290 WP_000106992.1.55294 WP_000106992.1.55310 WP_000106992.1.55317 WP_000106992.1.55325 WP_000106992.1.55361 WP_000106992.1.55379 WP_000106992.1.5539 WP_000106992.1.55418 WP_000106992.1.55430 WP_000106992.1.55461 WP_000106992.1.55468 WP_000106992.1.55475 WP_000106992.1.55477 WP_000106992.1.55496 WP_000106992.1.55506 WP_000106992.1.5552 WP_000106992.1.55528 WP_000106992.1.55545 WP_000106992.1.5555 WP_000106992.1.55554 WP_000106992.1.55557 WP_000106992.1.55559 WP_000106992.1.5560 WP_000106992.1.55604 WP_000106992.1.55614 WP_000106992.1.55623 WP_000106992.1.55639 WP_000106992.1.55640 WP_000106992.1.55647 WP_000106992.1.55672 WP_000106992.1.55680 WP_000106992.1.55699 WP_000106992.1.55706 WP_000106992.1.55718 WP_000106992.1.5572 WP_000106992.1.55725 WP_000106992.1.55743 WP_000106992.1.55768 WP_000106992.1.5577 WP_000106992.1.55780 WP_000106992.1.55782 WP_000106992.1.55796 WP_000106992.1.55803 WP_000106992.1.55853 WP_000106992.1.55923 WP_000106992.1.55948 WP_000106992.1.55967 WP_000106992.1.55973 WP_000106992.1.55995 WP_000106992.1.56002 WP_000106992.1.56004 WP_000106992.1.56012 WP_000106992.1.56026 WP_000106992.1.56059 WP_000106992.1.56069 WP_000106992.1.56082 WP_000106992.1.56097 WP_000106992.1.56100 WP_000106992.1.56105 WP_000106992.1.56130 WP_000106992.1.56144 WP_000106992.1.56152 WP_000106992.1.56172 WP_000106992.1.5621 WP_000106992.1.56226 WP_000106992.1.56235 WP_000106992.1.56238 WP_000106992.1.56244 WP_000106992.1.56261 WP_000106992.1.56263 WP_000106992.1.56286 WP_000106992.1.56303 WP_000106992.1.56304 WP_000106992.1.56305 WP_000106992.1.56311 WP_000106992.1.5633 WP_000106992.1.56354 WP_000106992.1.56368 WP_000106992.1.56370 WP_000106992.1.56385 WP_000106992.1.56389 WP_000106992.1.56393 WP_000106992.1.56396 WP_000106992.1.56413 WP_000106992.1.56414 WP_000106992.1.56419 WP_000106992.1.56420 WP_000106992.1.56423 WP_000106992.1.56438 WP_000106992.1.56468 WP_000106992.1.56512 WP_000106992.1.56514 WP_000106992.1.56535 WP_000106992.1.56559 WP_000106992.1.56560 WP_000106992.1.56585 WP_000106992.1.56597 WP_000106992.1.56601 WP_000106992.1.56614 WP_000106992.1.56615 WP_000106992.1.56640 WP_000106992.1.56642 WP_000106992.1.56647 WP_000106992.1.56651 WP_000106992.1.56660 WP_000106992.1.56671 WP_000106992.1.5668 WP_000106992.1.56682 WP_000106992.1.56724 WP_000106992.1.56824 WP_000106992.1.56825 WP_000106992.1.56851 WP_000106992.1.56853 WP_000106992.1.56861 WP_000106992.1.56875 WP_000106992.1.56877 WP_000106992.1.56887 WP_000106992.1.56889 WP_000106992.1.56893 WP_000106992.1.56898 WP_000106992.1.56905 WP_000106992.1.56950 WP_000106992.1.56981 WP_000106992.1.57000 WP_000106992.1.57026 WP_000106992.1.57039 WP_000106992.1.57056 WP_000106992.1.57076 WP_000106992.1.57084 WP_000106992.1.57101 WP_000106992.1.5711 WP_000106992.1.57125 WP_000106992.1.57137 WP_000106992.1.57143 WP_000106992.1.57147 WP_000106992.1.57149 WP_000106992.1.57168 WP_000106992.1.57179 WP_000106992.1.57186 WP_000106992.1.57187 WP_000106992.1.57233 WP_000106992.1.57246 WP_000106992.1.57296 WP_000106992.1.57307 WP_000106992.1.57342 WP_000106992.1.57344 WP_000106992.1.57356 WP_000106992.1.57357 WP_000106992.1.57362 WP_000106992.1.57377 WP_000106992.1.57399 WP_000106992.1.57418 WP_000106992.1.57433 WP_000106992.1.57494 WP_000106992.1.57495 WP_000106992.1.57510 WP_000106992.1.57515 WP_000106992.1.57529 WP_000106992.1.5753 WP_000106992.1.57534 WP_000106992.1.57559 WP_000106992.1.57576 WP_000106992.1.57601 WP_000106992.1.57607 WP_000106992.1.57631 WP_000106992.1.57684 WP_000106992.1.57699 WP_000106992.1.57709 WP_000106992.1.57710 WP_000106992.1.57735 WP_000106992.1.5774 WP_000106992.1.57763 WP_000106992.1.57778 WP_000106992.1.57781 WP_000106992.1.57785 WP_000106992.1.57797 WP_000106992.1.57800 WP_000106992.1.5781 WP_000106992.1.57835 WP_000106992.1.57857 WP_000106992.1.57862 WP_000106992.1.57873 WP_000106992.1.57890 WP_000106992.1.57891 WP_000106992.1.57893 WP_000106992.1.57965 WP_000106992.1.57972 WP_000106992.1.57978 WP_000106992.1.58008 WP_000106992.1.5801 WP_000106992.1.58040 WP_000106992.1.58041 WP_000106992.1.58044 WP_000106992.1.58081 WP_000106992.1.5809 WP_000106992.1.58090 WP_000106992.1.58131 WP_000106992.1.58132 WP_000106992.1.58144 WP_000106992.1.58153 WP_000106992.1.58157 WP_000106992.1.58173 WP_000106992.1.58191 WP_000106992.1.58194 WP_000106992.1.58239 WP_000106992.1.58249 WP_000106992.1.58251 WP_000106992.1.58252 WP_000106992.1.58261 WP_000106992.1.58274 WP_000106992.1.5828 WP_000106992.1.58282 WP_000106992.1.58290 WP_000106992.1.58301 WP_000106992.1.58324 WP_000106992.1.58326 WP_000106992.1.58334 WP_000106992.1.58357 WP_000106992.1.58358 WP_000106992.1.5836 WP_000106992.1.58372 WP_000106992.1.58407 WP_000106992.1.58416 WP_000106992.1.58418 WP_000106992.1.58442 WP_000106992.1.58443 WP_000106992.1.58451 WP_000106992.1.5846 WP_000106992.1.58485 WP_000106992.1.58486 WP_000106992.1.58489 WP_000106992.1.58537 WP_000106992.1.58548 WP_000106992.1.58564 WP_000106992.1.58568 WP_000106992.1.5858 WP_000106992.1.58583 WP_000106992.1.58604 WP_000106992.1.58633 WP_000106992.1.58652 WP_000106992.1.58662 WP_000106992.1.58663 WP_000106992.1.58669 WP_000106992.1.58675 WP_000106992.1.58698 WP_000106992.1.587 WP_000106992.1.58724 WP_000106992.1.58729 WP_000106992.1.58744 WP_000106992.1.58749 WP_000106992.1.5875 WP_000106992.1.58796 WP_000106992.1.58803 WP_000106992.1.58807 WP_000106992.1.58831 WP_000106992.1.58834 WP_000106992.1.58836 WP_000106992.1.58847 WP_000106992.1.5886 WP_000106992.1.58861 WP_000106992.1.58883 WP_000106992.1.58884 WP_000106992.1.58898 WP_000106992.1.58926 WP_000106992.1.58949 WP_000106992.1.58963 WP_000106992.1.58970 WP_000106992.1.58974 WP_000106992.1.59006 WP_000106992.1.59012 WP_000106992.1.59020 WP_000106992.1.59043 WP_000106992.1.59056 WP_000106992.1.59061 WP_000106992.1.59064 WP_000106992.1.59094 WP_000106992.1.59097 WP_000106992.1.59125 WP_000106992.1.59136 WP_000106992.1.59142 WP_000106992.1.59148 WP_000106992.1.59163 WP_000106992.1.59224 WP_000106992.1.59236 WP_000106992.1.59282 WP_000106992.1.5929 WP_000106992.1.59294 WP_000106992.1.59295 WP_000106992.1.59299 WP_000106992.1.59313 WP_000106992.1.59321 WP_000106992.1.59335 WP_000106992.1.59336 WP_000106992.1.59375 WP_000106992.1.59381 WP_000106992.1.59412 WP_000106992.1.59420 WP_000106992.1.59427 WP_000106992.1.59439 WP_000106992.1.59458 WP_000106992.1.59486 WP_000106992.1.5949 WP_000106992.1.59490 WP_000106992.1.59501 WP_000106992.1.59508 WP_000106992.1.59510 WP_000106992.1.59512 WP_000106992.1.59521 WP_000106992.1.59538 WP_000106992.1.59548 WP_000106992.1.59562 WP_000106992.1.59587 WP_000106992.1.59604 WP_000106992.1.59636 WP_000106992.1.59641 WP_000106992.1.59646 WP_000106992.1.59684 WP_000106992.1.5969 WP_000106992.1.59694 WP_000106992.1.59709 WP_000106992.1.59710 WP_000106992.1.59751 WP_000106992.1.59755 WP_000106992.1.59771 WP_000106992.1.5979 WP_000106992.1.59827 WP_000106992.1.59829 WP_000106992.1.59830 WP_000106992.1.59847 WP_000106992.1.59848 WP_000106992.1.59863 WP_000106992.1.59928 WP_000106992.1.59933 WP_000106992.1.59953 WP_000106992.1.59969 WP_000106992.1.59979 WP_000106992.1.59994 WP_000106992.1.60008 WP_000106992.1.60015 WP_000106992.1.60021 WP_000106992.1.60045 WP_000106992.1.60052 WP_000106992.1.60069 WP_000106992.1.60076 WP_000106992.1.60106 WP_000106992.1.60114 WP_000106992.1.60126 WP_000106992.1.60137 WP_000106992.1.60140 WP_000106992.1.60154 WP_000106992.1.60155 WP_000106992.1.60168 WP_000106992.1.60192 WP_000106992.1.60199 WP_000106992.1.60209 WP_000106992.1.60212 WP_000106992.1.60213 WP_000106992.1.60226 WP_000106992.1.60231 WP_000106992.1.60253 WP_000106992.1.60285 WP_000106992.1.60320 WP_000106992.1.60322 WP_000106992.1.60324 WP_000106992.1.6033 WP_000106992.1.60330 WP_000106992.1.60356 WP_000106992.1.60370 WP_000106992.1.60379 WP_000106992.1.6038 WP_000106992.1.60380 WP_000106992.1.6041 WP_000106992.1.60424 WP_000106992.1.60425 WP_000106992.1.60464 WP_000106992.1.60469 WP_000106992.1.60481 WP_000106992.1.605 WP_000106992.1.60503 WP_000106992.1.60507 WP_000106992.1.6052 WP_000106992.1.60545 WP_000106992.1.60560 WP_000106992.1.60561 WP_000106992.1.6058 WP_000106992.1.60584 WP_000106992.1.60597 WP_000106992.1.6060 WP_000106992.1.60608 WP_000106992.1.60622 WP_000106992.1.60643 WP_000106992.1.60661 WP_000106992.1.60676 WP_000106992.1.60708 WP_000106992.1.60713 WP_000106992.1.60725 WP_000106992.1.60746 WP_000106992.1.60760 WP_000106992.1.60772 WP_000106992.1.60783 WP_000106992.1.60792 WP_000106992.1.60794 WP_000106992.1.608 WP_000106992.1.60807 WP_000106992.1.60838 WP_000106992.1.60851 WP_000106992.1.60855 WP_000106992.1.60857 WP_000106992.1.6086 WP_000106992.1.60863 WP_000106992.1.60866 WP_000106992.1.60874 WP_000106992.1.60882 WP_000106992.1.60889 WP_000106992.1.60897 WP_000106992.1.6090 WP_000106992.1.60919 WP_000106992.1.60926 WP_000106992.1.60941 WP_000106992.1.60950 WP_000106992.1.60988 WP_000106992.1.60990 WP_000106992.1.6104 WP_000106992.1.61044 WP_000106992.1.61045 WP_000106992.1.61076 WP_000106992.1.61078 WP_000106992.1.6108 WP_000106992.1.61087 WP_000106992.1.61114 WP_000106992.1.61123 WP_000106992.1.6114 WP_000106992.1.61146 WP_000106992.1.61147 WP_000106992.1.61168 WP_000106992.1.61184 WP_000106992.1.61200 WP_000106992.1.61201 WP_000106992.1.61210 WP_000106992.1.61218 WP_000106992.1.61232 WP_000106992.1.61233 WP_000106992.1.6129 WP_000106992.1.61296 WP_000106992.1.61345 WP_000106992.1.61356 WP_000106992.1.61357 WP_000106992.1.61381 WP_000106992.1.61417 WP_000106992.1.61434 WP_000106992.1.61497 WP_000106992.1.61501 WP_000106992.1.61509 WP_000106992.1.61511 WP_000106992.1.61519 WP_000106992.1.61539 WP_000106992.1.61542 WP_000106992.1.61553 WP_000106992.1.61574 WP_000106992.1.61582 WP_000106992.1.61594 WP_000106992.1.61595 WP_000106992.1.61609 WP_000106992.1.6164 WP_000106992.1.61649 WP_000106992.1.61652 WP_000106992.1.61662 WP_000106992.1.61667 WP_000106992.1.61671 WP_000106992.1.61697 WP_000106992.1.61712 WP_000106992.1.61714 WP_000106992.1.61730 WP_000106992.1.61732 WP_000106992.1.61737 WP_000106992.1.61743 WP_000106992.1.61809 WP_000106992.1.61857 WP_000106992.1.61877 WP_000106992.1.6190 WP_000106992.1.61908 WP_000106992.1.61918 WP_000106992.1.61920 WP_000106992.1.61922 WP_000106992.1.61952 WP_000106992.1.61968 WP_000106992.1.62007 WP_000106992.1.62020 WP_000106992.1.62025 WP_000106992.1.62076 WP_000106992.1.6209 WP_000106992.1.6210 WP_000106992.1.62108 WP_000106992.1.62120 WP_000106992.1.62122 WP_000106992.1.62124 WP_000106992.1.62142 WP_000106992.1.62144 WP_000106992.1.62158 WP_000106992.1.62184 WP_000106992.1.62199 WP_000106992.1.62201 WP_000106992.1.62204 WP_000106992.1.62210 WP_000106992.1.62219 WP_000106992.1.62222 WP_000106992.1.62223 WP_000106992.1.62241 WP_000106992.1.62245 WP_000106992.1.62257 WP_000106992.1.62271 WP_000106992.1.62302 WP_000106992.1.62304 WP_000106992.1.62310 WP_000106992.1.62314 WP_000106992.1.62323 WP_000106992.1.62333 WP_000106992.1.62338 WP_000106992.1.62339 WP_000106992.1.62344 WP_000106992.1.62361 WP_000106992.1.62364 WP_000106992.1.62374 WP_000106992.1.62380 WP_000106992.1.62403 WP_000106992.1.62404 WP_000106992.1.62411 WP_000106992.1.62412 WP_000106992.1.62436 WP_000106992.1.62475 WP_000106992.1.62486 WP_000106992.1.62488 WP_000106992.1.62522 WP_000106992.1.6253 WP_000106992.1.62536 WP_000106992.1.62619 WP_000106992.1.62640 WP_000106992.1.62648 WP_000106992.1.62677 WP_000106992.1.62686 WP_000106992.1.62693 WP_000106992.1.627 WP_000106992.1.62725 WP_000106992.1.62745 WP_000106992.1.62751 WP_000106992.1.62757 WP_000106992.1.62798 WP_000106992.1.62825 WP_000106992.1.62828 WP_000106992.1.62853 WP_000106992.1.62903 WP_000106992.1.62910 WP_000106992.1.62913 WP_000106992.1.6292 WP_000106992.1.62932 WP_000106992.1.62955 WP_000106992.1.62960 WP_000106992.1.62976 WP_000106992.1.62983 WP_000106992.1.62988 WP_000106992.1.63016 WP_000106992.1.63025 WP_000106992.1.63043 WP_000106992.1.63045 WP_000106992.1.63069 WP_000106992.1.63087 WP_000106992.1.63102 WP_000106992.1.63118 WP_000106992.1.63129 WP_000106992.1.63135 WP_000106992.1.63150 WP_000106992.1.63155 WP_000106992.1.63169 WP_000106992.1.63181 WP_000106992.1.63186 WP_000106992.1.63203 WP_000106992.1.63229 WP_000106992.1.63234 WP_000106992.1.63243 WP_000106992.1.63256 WP_000106992.1.63290 WP_000106992.1.63297 WP_000106992.1.63358 WP_000106992.1.63382 WP_000106992.1.63422 WP_000106992.1.63432 WP_000106992.1.63448 WP_000106992.1.63455 WP_000106992.1.63461 WP_000106992.1.63479 WP_000106992.1.63497 WP_000106992.1.63499 WP_000106992.1.63509 WP_000106992.1.63514 WP_000106992.1.63525 WP_000106992.1.63529 WP_000106992.1.63532 WP_000106992.1.63568 WP_000106992.1.6357 WP_000106992.1.63577 WP_000106992.1.63583 WP_000106992.1.63585 WP_000106992.1.63592 WP_000106992.1.63603 WP_000106992.1.63633 WP_000106992.1.63663 WP_000106992.1.63664 WP_000106992.1.6367 WP_000106992.1.63677 WP_000106992.1.63690 WP_000106992.1.6370 WP_000106992.1.63718 WP_000106992.1.63731 WP_000106992.1.63736 WP_000106992.1.63748 WP_000106992.1.6375 WP_000106992.1.63757 WP_000106992.1.63766 WP_000106992.1.63781 WP_000106992.1.63782 WP_000106992.1.63797 WP_000106992.1.63816 WP_000106992.1.63824 WP_000106992.1.63831 WP_000106992.1.63834 WP_000106992.1.63851 WP_000106992.1.63860 WP_000106992.1.63863 WP_000106992.1.63864 WP_000106992.1.63866 WP_000106992.1.63876 WP_000106992.1.6389 WP_000106992.1.63901 WP_000106992.1.63903 WP_000106992.1.63912 WP_000106992.1.63934 WP_000106992.1.63955 WP_000106992.1.63958 WP_000106992.1.63963 WP_000106992.1.63977 WP_000106992.1.6399 WP_000106992.1.63992 WP_000106992.1.64007 WP_000106992.1.64010 WP_000106992.1.64018 WP_000106992.1.64032 WP_000106992.1.64034 WP_000106992.1.64046 WP_000106992.1.64072 WP_000106992.1.64085 WP_000106992.1.64087 WP_000106992.1.64109 WP_000106992.1.64121 WP_000106992.1.6415 WP_000106992.1.64157 WP_000106992.1.64208 WP_000106992.1.64217 WP_000106992.1.64229 WP_000106992.1.6423 WP_000106992.1.64242 WP_000106992.1.64244 WP_000106992.1.64266 WP_000106992.1.64293 WP_000106992.1.64294 WP_000106992.1.64332 WP_000106992.1.64350 WP_000106992.1.6437 WP_000106992.1.64374 WP_000106992.1.64376 WP_000106992.1.64385 WP_000106992.1.64387 WP_000106992.1.64389 WP_000106992.1.644 WP_000106992.1.64403 WP_000106992.1.64462 WP_000106992.1.64471 WP_000106992.1.64500 WP_000106992.1.64501 WP_000106992.1.6451 WP_000106992.1.64538 WP_000106992.1.64569 WP_000106992.1.64597 WP_000106992.1.64632 WP_000106992.1.64645 WP_000106992.1.64648 WP_000106992.1.64649 WP_000106992.1.64654 WP_000106992.1.64662 WP_000106992.1.64663 WP_000106992.1.64667 WP_000106992.1.64674 WP_000106992.1.64690 WP_000106992.1.64702 WP_000106992.1.64709 WP_000106992.1.64710 WP_000106992.1.64711 WP_000106992.1.64744 WP_000106992.1.64757 WP_000106992.1.64763 WP_000106992.1.64771 WP_000106992.1.64781 WP_000106992.1.64798 WP_000106992.1.64817 WP_000106992.1.64831 WP_000106992.1.64847 WP_000106992.1.6487 WP_000106992.1.6489 WP_000106992.1.64891 WP_000106992.1.64894 WP_000106992.1.64919 WP_000106992.1.64920 WP_000106992.1.64944 WP_000106992.1.64972 WP_000106992.1.64974 WP_000106992.1.64977 WP_000106992.1.65011 WP_000106992.1.65016 WP_000106992.1.65018 WP_000106992.1.65022 WP_000106992.1.65027 WP_000106992.1.65028 WP_000106992.1.65052 WP_000106992.1.65054 WP_000106992.1.65075 WP_000106992.1.6514 WP_000106992.1.65163 WP_000106992.1.65168 WP_000106992.1.65171 WP_000106992.1.65172 WP_000106992.1.65185 WP_000106992.1.65191 WP_000106992.1.65200 WP_000106992.1.65211 WP_000106992.1.65218 WP_000106992.1.65226 WP_000106992.1.65238 WP_000106992.1.65248 WP_000106992.1.65249 WP_000106992.1.65266 WP_000106992.1.65269 WP_000106992.1.65295 WP_000106992.1.65348 WP_000106992.1.65357 WP_000106992.1.65363 WP_000106992.1.65394 WP_000106992.1.65395 WP_000106992.1.65437 WP_000106992.1.65459 WP_000106992.1.65463 WP_000106992.1.65474 WP_000106992.1.65487 WP_000106992.1.6549 WP_000106992.1.65499 WP_000106992.1.6550 WP_000106992.1.65508 WP_000106992.1.65538 WP_000106992.1.6554 WP_000106992.1.65558 WP_000106992.1.6560 WP_000106992.1.65601 WP_000106992.1.6561 WP_000106992.1.65633 WP_000106992.1.6565 WP_000106992.1.65650 WP_000106992.1.65687 WP_000106992.1.65696 WP_000106992.1.65697 WP_000106992.1.65698 WP_000106992.1.65699 WP_000106992.1.6572 WP_000106992.1.65737 WP_000106992.1.6575 WP_000106992.1.65755 WP_000106992.1.65771 WP_000106992.1.65782 WP_000106992.1.65790 WP_000106992.1.65795 WP_000106992.1.65812 WP_000106992.1.65838 WP_000106992.1.65846 WP_000106992.1.65849 WP_000106992.1.65863 WP_000106992.1.65876 WP_000106992.1.65881 WP_000106992.1.65883 WP_000106992.1.65901 WP_000106992.1.6594 WP_000106992.1.65940 WP_000106992.1.6595 WP_000106992.1.65956 WP_000106992.1.65968 WP_000106992.1.65985 WP_000106992.1.66021 WP_000106992.1.66031 WP_000106992.1.66049 WP_000106992.1.66052 WP_000106992.1.66064 WP_000106992.1.66074 WP_000106992.1.66082 WP_000106992.1.66085 WP_000106992.1.66109 WP_000106992.1.66122 WP_000106992.1.66129 WP_000106992.1.66145 WP_000106992.1.66167 WP_000106992.1.66171 WP_000106992.1.66183 WP_000106992.1.6620 WP_000106992.1.66216 WP_000106992.1.66234 WP_000106992.1.66235 WP_000106992.1.66250 WP_000106992.1.66270 WP_000106992.1.66272 WP_000106992.1.66289 WP_000106992.1.6630 WP_000106992.1.66314 WP_000106992.1.66315 WP_000106992.1.66324 WP_000106992.1.66330 WP_000106992.1.6634 WP_000106992.1.66358 WP_000106992.1.66361 WP_000106992.1.66362 WP_000106992.1.66365 WP_000106992.1.66368 WP_000106992.1.6638 WP_000106992.1.66385 WP_000106992.1.6640 WP_000106992.1.66400 WP_000106992.1.66428 WP_000106992.1.66446 WP_000106992.1.66462 WP_000106992.1.6647 WP_000106992.1.66480 WP_000106992.1.66492 WP_000106992.1.66506 WP_000106992.1.66534 WP_000106992.1.66539 WP_000106992.1.66600 WP_000106992.1.66630 WP_000106992.1.66665 WP_000106992.1.66678 WP_000106992.1.66681 WP_000106992.1.66684 WP_000106992.1.66698 WP_000106992.1.66702 WP_000106992.1.66733 WP_000106992.1.66755 WP_000106992.1.66759 WP_000106992.1.66779 WP_000106992.1.6680 WP_000106992.1.66800 WP_000106992.1.66801 WP_000106992.1.66807 WP_000106992.1.66820 WP_000106992.1.66825 WP_000106992.1.66834 WP_000106992.1.66860 WP_000106992.1.66876 WP_000106992.1.66901 WP_000106992.1.66937 WP_000106992.1.66953 WP_000106992.1.66955 WP_000106992.1.66959 WP_000106992.1.66962 WP_000106992.1.66981 WP_000106992.1.67 WP_000106992.1.67024 WP_000106992.1.67037 WP_000106992.1.67042 WP_000106992.1.67045 WP_000106992.1.67075 WP_000106992.1.6710 WP_000106992.1.67100 WP_000106992.1.67101 WP_000106992.1.67143 WP_000106992.1.67173 WP_000106992.1.67175 WP_000106992.1.67181 WP_000106992.1.67184 WP_000106992.1.67201 WP_000106992.1.67211 WP_000106992.1.67235 WP_000106992.1.67237 WP_000106992.1.67268 WP_000106992.1.67279 WP_000106992.1.67288 WP_000106992.1.67336 WP_000106992.1.67339 WP_000106992.1.67347 WP_000106992.1.67374 WP_000106992.1.67387 WP_000106992.1.6739 WP_000106992.1.67394 WP_000106992.1.67397 WP_000106992.1.67403 WP_000106992.1.67405 WP_000106992.1.67424 WP_000106992.1.67430 WP_000106992.1.67442 WP_000106992.1.67465 WP_000106992.1.67539 WP_000106992.1.67552 WP_000106992.1.67556 WP_000106992.1.67576 WP_000106992.1.6760 WP_000106992.1.67603 WP_000106992.1.67604 WP_000106992.1.67617 WP_000106992.1.67619 WP_000106992.1.67625 WP_000106992.1.67627 WP_000106992.1.67633 WP_000106992.1.67637 WP_000106992.1.67641 WP_000106992.1.67657 WP_000106992.1.67673 WP_000106992.1.67682 WP_000106992.1.67700 WP_000106992.1.67707 WP_000106992.1.67718 WP_000106992.1.67729 WP_000106992.1.67731 WP_000106992.1.67772 WP_000106992.1.67774 WP_000106992.1.67776 WP_000106992.1.67803 WP_000106992.1.67814 WP_000106992.1.6782 WP_000106992.1.67820 WP_000106992.1.67827 WP_000106992.1.67829 WP_000106992.1.6785 WP_000106992.1.67887 WP_000106992.1.67905 WP_000106992.1.67910 WP_000106992.1.67924 WP_000106992.1.67932 WP_000106992.1.67942 WP_000106992.1.67954 WP_000106992.1.67969 WP_000106992.1.67977 WP_000106992.1.67988 WP_000106992.1.68 WP_000106992.1.68036 WP_000106992.1.68043 WP_000106992.1.68073 WP_000106992.1.68075 WP_000106992.1.6809 WP_000106992.1.68105 WP_000106992.1.68113 WP_000106992.1.68115 WP_000106992.1.68131 WP_000106992.1.68140 WP_000106992.1.68159 WP_000106992.1.68167 WP_000106992.1.68182 WP_000106992.1.6819 WP_000106992.1.68201 WP_000106992.1.68206 WP_000106992.1.68210 WP_000106992.1.6827 WP_000106992.1.68275 WP_000106992.1.68285 WP_000106992.1.6833 WP_000106992.1.68359 WP_000106992.1.68401 WP_000106992.1.68420 WP_000106992.1.68477 WP_000106992.1.68478 WP_000106992.1.6849 WP_000106992.1.685 WP_000106992.1.68514 WP_000106992.1.68532 WP_000106992.1.68547 WP_000106992.1.68564 WP_000106992.1.6857 WP_000106992.1.6858 WP_000106992.1.68589 WP_000106992.1.68591 WP_000106992.1.68629 WP_000106992.1.68652 WP_000106992.1.68656 WP_000106992.1.68658 WP_000106992.1.68677 WP_000106992.1.68688 WP_000106992.1.6869 WP_000106992.1.68690 WP_000106992.1.68742 WP_000106992.1.6875 WP_000106992.1.68770 WP_000106992.1.68778 WP_000106992.1.68787 WP_000106992.1.6879 WP_000106992.1.68809 WP_000106992.1.68816 WP_000106992.1.68818 WP_000106992.1.6882 WP_000106992.1.6883 WP_000106992.1.68893 WP_000106992.1.68894 WP_000106992.1.68895 WP_000106992.1.68914 WP_000106992.1.68928 WP_000106992.1.68958 WP_000106992.1.68966 WP_000106992.1.68975 WP_000106992.1.68999 WP_000106992.1.69001 WP_000106992.1.69006 WP_000106992.1.69011 WP_000106992.1.69029 WP_000106992.1.6904 WP_000106992.1.6905 WP_000106992.1.69053 WP_000106992.1.69058 WP_000106992.1.6907 WP_000106992.1.69080 WP_000106992.1.69086 WP_000106992.1.6913 WP_000106992.1.69131 WP_000106992.1.69139 WP_000106992.1.69146 WP_000106992.1.69151 WP_000106992.1.69170 WP_000106992.1.69210 WP_000106992.1.69236 WP_000106992.1.69255 WP_000106992.1.69270 WP_000106992.1.69273 WP_000106992.1.69282 WP_000106992.1.69288 WP_000106992.1.69296 WP_000106992.1.69320 WP_000106992.1.69346 WP_000106992.1.69357 WP_000106992.1.69359 WP_000106992.1.69371 WP_000106992.1.69376 WP_000106992.1.69385 WP_000106992.1.69396 WP_000106992.1.69397 WP_000106992.1.69465 WP_000106992.1.69466 WP_000106992.1.69485 WP_000106992.1.69515 WP_000106992.1.6954 WP_000106992.1.69554 WP_000106992.1.69564 WP_000106992.1.69575 WP_000106992.1.69588 WP_000106992.1.69597 WP_000106992.1.69611 WP_000106992.1.69616 WP_000106992.1.69636 WP_000106992.1.69642 WP_000106992.1.69644 WP_000106992.1.69656 WP_000106992.1.69657 WP_000106992.1.69690 WP_000106992.1.69696 WP_000106992.1.69704 WP_000106992.1.69710 WP_000106992.1.69754 WP_000106992.1.69758 WP_000106992.1.69760 WP_000106992.1.69767 WP_000106992.1.69785 WP_000106992.1.69787 WP_000106992.1.69790 WP_000106992.1.69807 WP_000106992.1.69808 WP_000106992.1.69817 WP_000106992.1.69848 WP_000106992.1.69923 WP_000106992.1.69948 WP_000106992.1.69953 WP_000106992.1.69965 WP_000106992.1.69975 WP_000106992.1.69977 WP_000106992.1.69982 WP_000106992.1.70003 WP_000106992.1.70010 WP_000106992.1.70028 WP_000106992.1.70047 WP_000106992.1.70049 WP_000106992.1.70058 WP_000106992.1.70061 WP_000106992.1.70087 WP_000106992.1.70088 WP_000106992.1.7010 WP_000106992.1.7014 WP_000106992.1.7016 WP_000106992.1.70169 WP_000106992.1.70183 WP_000106992.1.70205 WP_000106992.1.7021 WP_000106992.1.70240 WP_000106992.1.70241 WP_000106992.1.70248 WP_000106992.1.70249 WP_000106992.1.70261 WP_000106992.1.70269 WP_000106992.1.70272 WP_000106992.1.70281 WP_000106992.1.70289 WP_000106992.1.70290 WP_000106992.1.70303 WP_000106992.1.70314 WP_000106992.1.70321 WP_000106992.1.70326 WP_000106992.1.70327 WP_000106992.1.7033 WP_000106992.1.70355 WP_000106992.1.70427 WP_000106992.1.70433 WP_000106992.1.7044 WP_000106992.1.70440 WP_000106992.1.70447 WP_000106992.1.70485 WP_000106992.1.70488 WP_000106992.1.70491 WP_000106992.1.70523 WP_000106992.1.70531 WP_000106992.1.70545 WP_000106992.1.70547 WP_000106992.1.70580 WP_000106992.1.70596 WP_000106992.1.70623 WP_000106992.1.70643 WP_000106992.1.70644 WP_000106992.1.70671 WP_000106992.1.70678 WP_000106992.1.70679 WP_000106992.1.70683 WP_000106992.1.70685 WP_000106992.1.70708 WP_000106992.1.70712 WP_000106992.1.70717 WP_000106992.1.70731 WP_000106992.1.70732 WP_000106992.1.70733 WP_000106992.1.70761 WP_000106992.1.70772 WP_000106992.1.70785 WP_000106992.1.70792 WP_000106992.1.70797 WP_000106992.1.70837 WP_000106992.1.70845 WP_000106992.1.70846 WP_000106992.1.70869 WP_000106992.1.70883 WP_000106992.1.70899 WP_000106992.1.70914 WP_000106992.1.70922 WP_000106992.1.70929 WP_000106992.1.7093 WP_000106992.1.70948 WP_000106992.1.70959 WP_000106992.1.70969 WP_000106992.1.70971 WP_000106992.1.70977 WP_000106992.1.70981 WP_000106992.1.70986 WP_000106992.1.70995 WP_000106992.1.71007 WP_000106992.1.71010 WP_000106992.1.71023 WP_000106992.1.71039 WP_000106992.1.71057 WP_000106992.1.71069 WP_000106992.1.71081 WP_000106992.1.71088 WP_000106992.1.7110 WP_000106992.1.71117 WP_000106992.1.71120 WP_000106992.1.71146 WP_000106992.1.71150 WP_000106992.1.71165 WP_000106992.1.71171 WP_000106992.1.71172 WP_000106992.1.71184 WP_000106992.1.71186 WP_000106992.1.71188 WP_000106992.1.71201 WP_000106992.1.71202 WP_000106992.1.71243 WP_000106992.1.71248 WP_000106992.1.71268 WP_000106992.1.71305 WP_000106992.1.71306 WP_000106992.1.71337 WP_000106992.1.7134 WP_000106992.1.71363 WP_000106992.1.71368 WP_000106992.1.71378 WP_000106992.1.714 WP_000106992.1.71401 WP_000106992.1.71407 WP_000106992.1.7142 WP_000106992.1.71446 WP_000106992.1.71450 WP_000106992.1.71452 WP_000106992.1.71455 WP_000106992.1.71456 WP_000106992.1.71481 WP_000106992.1.71487 WP_000106992.1.71523 WP_000106992.1.71542 WP_000106992.1.71566 WP_000106992.1.71583 WP_000106992.1.71600 WP_000106992.1.71626 WP_000106992.1.71636 WP_000106992.1.71640 WP_000106992.1.71649 WP_000106992.1.71651 WP_000106992.1.71653 WP_000106992.1.71667 WP_000106992.1.71702 WP_000106992.1.71716 WP_000106992.1.7174 WP_000106992.1.71746 WP_000106992.1.71750 WP_000106992.1.71756 WP_000106992.1.71798 WP_000106992.1.71845 WP_000106992.1.71872 WP_000106992.1.71881 WP_000106992.1.71908 WP_000106992.1.71923 WP_000106992.1.71929 WP_000106992.1.71941 WP_000106992.1.71950 WP_000106992.1.71952 WP_000106992.1.71954 WP_000106992.1.71973 WP_000106992.1.71979 WP_000106992.1.71984 WP_000106992.1.71985 WP_000106992.1.720 WP_000106992.1.72003 WP_000106992.1.72065 WP_000106992.1.72068 WP_000106992.1.72073 WP_000106992.1.72100 WP_000106992.1.72105 WP_000106992.1.72107 WP_000106992.1.72119 WP_000106992.1.72182 WP_000106992.1.72188 WP_000106992.1.72190 WP_000106992.1.72203 WP_000106992.1.72220 WP_000106992.1.72221 WP_000106992.1.72226 WP_000106992.1.72234 WP_000106992.1.72243 WP_000106992.1.72269 WP_000106992.1.72277 WP_000106992.1.72281 WP_000106992.1.72283 WP_000106992.1.72300 WP_000106992.1.72325 WP_000106992.1.72339 WP_000106992.1.72350 WP_000106992.1.72351 WP_000106992.1.72376 WP_000106992.1.72382 WP_000106992.1.72383 WP_000106992.1.72403 WP_000106992.1.72412 WP_000106992.1.7243 WP_000106992.1.72438 WP_000106992.1.72461 WP_000106992.1.72470 WP_000106992.1.72527 WP_000106992.1.72532 WP_000106992.1.7255 WP_000106992.1.72594 WP_000106992.1.72602 WP_000106992.1.72625 WP_000106992.1.72629 WP_000106992.1.72631 WP_000106992.1.72638 WP_000106992.1.72642 WP_000106992.1.72667 WP_000106992.1.72671 WP_000106992.1.72674 WP_000106992.1.72689 WP_000106992.1.72716 WP_000106992.1.72718 WP_000106992.1.72724 WP_000106992.1.72728 WP_000106992.1.72789 WP_000106992.1.72793 WP_000106992.1.72827 WP_000106992.1.72828 WP_000106992.1.72843 WP_000106992.1.72850 WP_000106992.1.72865 WP_000106992.1.72871 WP_000106992.1.72872 WP_000106992.1.72887 WP_000106992.1.72892 WP_000106992.1.72894 WP_000106992.1.72896 WP_000106992.1.72897 WP_000106992.1.72944 WP_000106992.1.7295 WP_000106992.1.72968 WP_000106992.1.72969 WP_000106992.1.72975 WP_000106992.1.72987 WP_000106992.1.7304 WP_000106992.1.73052 WP_000106992.1.73068 WP_000106992.1.7311 WP_000106992.1.73114 WP_000106992.1.73125 WP_000106992.1.73144 WP_000106992.1.7315 WP_000106992.1.7316 WP_000106992.1.73164 WP_000106992.1.73177 WP_000106992.1.73180 WP_000106992.1.73200 WP_000106992.1.73258 WP_000106992.1.73270 WP_000106992.1.73285 WP_000106992.1.7332 WP_000106992.1.73328 WP_000106992.1.7333 WP_000106992.1.7334 WP_000106992.1.73352 WP_000106992.1.73362 WP_000106992.1.73377 WP_000106992.1.73379 WP_000106992.1.73389 WP_000106992.1.7341 WP_000106992.1.73425 WP_000106992.1.73461 WP_000106992.1.73481 WP_000106992.1.73488 WP_000106992.1.73504 WP_000106992.1.73512 WP_000106992.1.7353 WP_000106992.1.73535 WP_000106992.1.73544 WP_000106992.1.7356 WP_000106992.1.73561 WP_000106992.1.73581 WP_000106992.1.73596 WP_000106992.1.73598 WP_000106992.1.7361 WP_000106992.1.73617 WP_000106992.1.73648 WP_000106992.1.73669 WP_000106992.1.73701 WP_000106992.1.73708 WP_000106992.1.7374 WP_000106992.1.73753 WP_000106992.1.73758 WP_000106992.1.73764 WP_000106992.1.73768 WP_000106992.1.73794 WP_000106992.1.73804 WP_000106992.1.73831 WP_000106992.1.73847 WP_000106992.1.73849 WP_000106992.1.7386 WP_000106992.1.7387 WP_000106992.1.73901 WP_000106992.1.73924 WP_000106992.1.7394 WP_000106992.1.73945 WP_000106992.1.73948 WP_000106992.1.73956 WP_000106992.1.73999 WP_000106992.1.74024 WP_000106992.1.74028 WP_000106992.1.74029 WP_000106992.1.74030 WP_000106992.1.74038 WP_000106992.1.74040 WP_000106992.1.74043 WP_000106992.1.74049 WP_000106992.1.7405 WP_000106992.1.74058 WP_000106992.1.74070 WP_000106992.1.74077 WP_000106992.1.74089 WP_000106992.1.74117 WP_000106992.1.74135 WP_000106992.1.74174 WP_000106992.1.74181 WP_000106992.1.74191 WP_000106992.1.74207 WP_000106992.1.74214 WP_000106992.1.74228 WP_000106992.1.74241 WP_000106992.1.74285 WP_000106992.1.743 WP_000106992.1.7430 WP_000106992.1.74300 WP_000106992.1.74317 WP_000106992.1.7433 WP_000106992.1.74379 WP_000106992.1.74410 WP_000106992.1.74414 WP_000106992.1.74415 WP_000106992.1.74418 WP_000106992.1.74422 WP_000106992.1.74428 WP_000106992.1.7444 WP_000106992.1.74454 WP_000106992.1.74466 WP_000106992.1.74469 WP_000106992.1.74481 WP_000106992.1.745 WP_000106992.1.74500 WP_000106992.1.74529 WP_000106992.1.74570 WP_000106992.1.74578 WP_000106992.1.7458 WP_000106992.1.74616 WP_000106992.1.74620 WP_000106992.1.74621 WP_000106992.1.74632 WP_000106992.1.74639 WP_000106992.1.74644 WP_000106992.1.74647 WP_000106992.1.74661 WP_000106992.1.74677 WP_000106992.1.74699 WP_000106992.1.74702 WP_000106992.1.74745 WP_000106992.1.74757 WP_000106992.1.74806 WP_000106992.1.74807 WP_000106992.1.74831 WP_000106992.1.74876 WP_000106992.1.74884 WP_000106992.1.74894 WP_000106992.1.7491 WP_000106992.1.74929 WP_000106992.1.74939 WP_000106992.1.74946 WP_000106992.1.74972 WP_000106992.1.74973 WP_000106992.1.74992 WP_000106992.1.74996 WP_000106992.1.75009 WP_000106992.1.75051 WP_000106992.1.75056 WP_000106992.1.7507 WP_000106992.1.75089 WP_000106992.1.75114 WP_000106992.1.75116 WP_000106992.1.75129 WP_000106992.1.75134 WP_000106992.1.75148 WP_000106992.1.75159 WP_000106992.1.75168 WP_000106992.1.75177 WP_000106992.1.75180 WP_000106992.1.75187 WP_000106992.1.75237 WP_000106992.1.75273 WP_000106992.1.75288 WP_000106992.1.75296 WP_000106992.1.75301 WP_000106992.1.7531 WP_000106992.1.75334 WP_000106992.1.75362 WP_000106992.1.75385 WP_000106992.1.75392 WP_000106992.1.75400 WP_000106992.1.75402 WP_000106992.1.75413 WP_000106992.1.75433 WP_000106992.1.75450 WP_000106992.1.75532 WP_000106992.1.75565 WP_000106992.1.7558 WP_000106992.1.75593 WP_000106992.1.75607 WP_000106992.1.75609 WP_000106992.1.75610 WP_000106992.1.75633 WP_000106992.1.75664 WP_000106992.1.75703 WP_000106992.1.75716 WP_000106992.1.75718 WP_000106992.1.75740 WP_000106992.1.75745 WP_000106992.1.75751 WP_000106992.1.75760 WP_000106992.1.75764 WP_000106992.1.75793 WP_000106992.1.75794 WP_000106992.1.75810 WP_000106992.1.75828 WP_000106992.1.75837 WP_000106992.1.75844 WP_000106992.1.75863 WP_000106992.1.75873 WP_000106992.1.75874 WP_000106992.1.75884 WP_000106992.1.75886 WP_000106992.1.75898 WP_000106992.1.75902 WP_000106992.1.75932 WP_000106992.1.75945 WP_000106992.1.75957 WP_000106992.1.76 WP_000106992.1.76020 WP_000106992.1.76024 WP_000106992.1.76055 WP_000106992.1.76081 WP_000106992.1.76097 WP_000106992.1.76102 WP_000106992.1.76108 WP_000106992.1.76116 WP_000106992.1.76122 WP_000106992.1.76137 WP_000106992.1.76156 WP_000106992.1.76164 WP_000106992.1.76170 WP_000106992.1.76186 WP_000106992.1.76197 WP_000106992.1.76208 WP_000106992.1.76252 WP_000106992.1.76256 WP_000106992.1.7629 WP_000106992.1.76301 WP_000106992.1.76327 WP_000106992.1.7633 WP_000106992.1.76339 WP_000106992.1.76345 WP_000106992.1.76346 WP_000106992.1.76364 WP_000106992.1.76366 WP_000106992.1.76417 WP_000106992.1.76434 WP_000106992.1.76445 WP_000106992.1.76451 WP_000106992.1.7646 WP_000106992.1.76471 WP_000106992.1.76495 WP_000106992.1.76510 WP_000106992.1.76529 WP_000106992.1.76532 WP_000106992.1.76548 WP_000106992.1.7655 WP_000106992.1.76558 WP_000106992.1.7657 WP_000106992.1.76572 WP_000106992.1.76576 WP_000106992.1.7660 WP_000106992.1.76611 WP_000106992.1.76641 WP_000106992.1.76651 WP_000106992.1.76653 WP_000106992.1.76673 WP_000106992.1.76706 WP_000106992.1.7672 WP_000106992.1.76721 WP_000106992.1.76724 WP_000106992.1.76738 WP_000106992.1.76756 WP_000106992.1.76760 WP_000106992.1.76776 WP_000106992.1.76788 WP_000106992.1.76799 WP_000106992.1.76806 WP_000106992.1.7684 WP_000106992.1.76854 WP_000106992.1.76866 WP_000106992.1.76875 WP_000106992.1.76880 WP_000106992.1.76899 WP_000106992.1.76913 WP_000106992.1.76916 WP_000106992.1.76932 WP_000106992.1.76968 WP_000106992.1.76973 WP_000106992.1.76988 WP_000106992.1.77016 WP_000106992.1.77017 WP_000106992.1.77033 WP_000106992.1.77038 WP_000106992.1.77047 WP_000106992.1.77067 WP_000106992.1.77080 WP_000106992.1.77087 WP_000106992.1.77090 WP_000106992.1.77111 WP_000106992.1.7712 WP_000106992.1.77177 WP_000106992.1.77180 WP_000106992.1.77184 WP_000106992.1.77193 WP_000106992.1.77241 WP_000106992.1.77244 WP_000106992.1.77267 WP_000106992.1.77271 WP_000106992.1.77292 WP_000106992.1.77299 WP_000106992.1.77306 WP_000106992.1.77349 WP_000106992.1.77356 WP_000106992.1.77384 WP_000106992.1.77390 WP_000106992.1.77414 WP_000106992.1.77431 WP_000106992.1.77436 WP_000106992.1.77440 WP_000106992.1.77475 WP_000106992.1.77496 WP_000106992.1.77501 WP_000106992.1.77512 WP_000106992.1.77513 WP_000106992.1.77514 WP_000106992.1.77529 WP_000106992.1.77543 WP_000106992.1.77549 WP_000106992.1.77555 WP_000106992.1.77563 WP_000106992.1.77575 WP_000106992.1.77596 WP_000106992.1.77629 WP_000106992.1.77653 WP_000106992.1.77692 WP_000106992.1.77702 WP_000106992.1.77710 WP_000106992.1.77713 WP_000106992.1.7772 WP_000106992.1.77729 WP_000106992.1.77754 WP_000106992.1.77761 WP_000106992.1.7782 WP_000106992.1.77825 WP_000106992.1.77837 WP_000106992.1.77846 WP_000106992.1.77851 WP_000106992.1.77871 WP_000106992.1.77898 WP_000106992.1.77900 WP_000106992.1.77918 WP_000106992.1.7792 WP_000106992.1.77923 WP_000106992.1.7793 WP_000106992.1.77951 WP_000106992.1.77960 WP_000106992.1.77971 WP_000106992.1.77975 WP_000106992.1.77983 WP_000106992.1.77987 WP_000106992.1.77989 WP_000106992.1.78 WP_000106992.1.7802 WP_000106992.1.78033 WP_000106992.1.78035 WP_000106992.1.78048 WP_000106992.1.78051 WP_000106992.1.78076 WP_000106992.1.78096 WP_000106992.1.78100 WP_000106992.1.78107 WP_000106992.1.78110 WP_000106992.1.78120 WP_000106992.1.7814 WP_000106992.1.78166 WP_000106992.1.78168 WP_000106992.1.78170 WP_000106992.1.78180 WP_000106992.1.78192 WP_000106992.1.78195 WP_000106992.1.78201 WP_000106992.1.78245 WP_000106992.1.78259 WP_000106992.1.78291 WP_000106992.1.78301 WP_000106992.1.78309 WP_000106992.1.78320 WP_000106992.1.78339 WP_000106992.1.78366 WP_000106992.1.78372 WP_000106992.1.78382 WP_000106992.1.78383 WP_000106992.1.78388 WP_000106992.1.78407 WP_000106992.1.78410 WP_000106992.1.78443 WP_000106992.1.78495 WP_000106992.1.78496 WP_000106992.1.78501 WP_000106992.1.78502 WP_000106992.1.78602 WP_000106992.1.78603 WP_000106992.1.7861 WP_000106992.1.78618 WP_000106992.1.7862 WP_000106992.1.78626 WP_000106992.1.78632 WP_000106992.1.78658 WP_000106992.1.78661 WP_000106992.1.78673 WP_000106992.1.78674 WP_000106992.1.78676 WP_000106992.1.78697 WP_000106992.1.78715 WP_000106992.1.78734 WP_000106992.1.78735 WP_000106992.1.78738 WP_000106992.1.78761 WP_000106992.1.7877 WP_000106992.1.78771 WP_000106992.1.78789 WP_000106992.1.78802 WP_000106992.1.78815 WP_000106992.1.78830 WP_000106992.1.78835 WP_000106992.1.78838 WP_000106992.1.78862 WP_000106992.1.78871 WP_000106992.1.78874 WP_000106992.1.78877 WP_000106992.1.78881 WP_000106992.1.78896 WP_000106992.1.789 WP_000106992.1.7891 WP_000106992.1.78913 WP_000106992.1.78918 WP_000106992.1.78928 WP_000106992.1.7893 WP_000106992.1.78930 WP_000106992.1.78951 WP_000106992.1.78993 WP_000106992.1.79011 WP_000106992.1.79012 WP_000106992.1.79032 WP_000106992.1.79069 WP_000106992.1.79074 WP_000106992.1.79081 WP_000106992.1.79098 WP_000106992.1.79099 WP_000106992.1.79140 WP_000106992.1.79151 WP_000106992.1.79155 WP_000106992.1.79164 WP_000106992.1.79167 WP_000106992.1.79189 WP_000106992.1.79203 WP_000106992.1.79204 WP_000106992.1.79235 WP_000106992.1.79280 WP_000106992.1.79289 WP_000106992.1.79297 WP_000106992.1.79302 WP_000106992.1.79335 WP_000106992.1.79370 WP_000106992.1.79397 WP_000106992.1.794 WP_000106992.1.79427 WP_000106992.1.79456 WP_000106992.1.79462 WP_000106992.1.79468 WP_000106992.1.79490 WP_000106992.1.79495 WP_000106992.1.79529 WP_000106992.1.79532 WP_000106992.1.79547 WP_000106992.1.7956 WP_000106992.1.79570 WP_000106992.1.79580 WP_000106992.1.79586 WP_000106992.1.7964 WP_000106992.1.79642 WP_000106992.1.79645 WP_000106992.1.79654 WP_000106992.1.79659 WP_000106992.1.79668 WP_000106992.1.7970 WP_000106992.1.79708 WP_000106992.1.7972 WP_000106992.1.79722 WP_000106992.1.79734 WP_000106992.1.79738 WP_000106992.1.79757 WP_000106992.1.79772 WP_000106992.1.79778 WP_000106992.1.7979 WP_000106992.1.7982 WP_000106992.1.79832 WP_000106992.1.79845 WP_000106992.1.79867 WP_000106992.1.79880 WP_000106992.1.79892 WP_000106992.1.7991 WP_000106992.1.79910 WP_000106992.1.79914 WP_000106992.1.79916 WP_000106992.1.79929 WP_000106992.1.79934 WP_000106992.1.7994 WP_000106992.1.79945 WP_000106992.1.79951 WP_000106992.1.79966 WP_000106992.1.79974 WP_000106992.1.79996 WP_000106992.1.80065 WP_000106992.1.80077 WP_000106992.1.80103 WP_000106992.1.80137 WP_000106992.1.80149 WP_000106992.1.80182 WP_000106992.1.80229 WP_000106992.1.80236 WP_000106992.1.8024 WP_000106992.1.80249 WP_000106992.1.80250 WP_000106992.1.80254 WP_000106992.1.80273 WP_000106992.1.80282 WP_000106992.1.80293 WP_000106992.1.80296 WP_000106992.1.80307 WP_000106992.1.80333 WP_000106992.1.80354 WP_000106992.1.80366 WP_000106992.1.80368 WP_000106992.1.80380 WP_000106992.1.80386 WP_000106992.1.80400 WP_000106992.1.80441 WP_000106992.1.80443 WP_000106992.1.80448 WP_000106992.1.80462 WP_000106992.1.80473 WP_000106992.1.80479 WP_000106992.1.80480 WP_000106992.1.8049 WP_000106992.1.80492 WP_000106992.1.80496 WP_000106992.1.80529 WP_000106992.1.80542 WP_000106992.1.80569 WP_000106992.1.80586 WP_000106992.1.80609 WP_000106992.1.80629 WP_000106992.1.80638 WP_000106992.1.80651 WP_000106992.1.80664 WP_000106992.1.80667 WP_000106992.1.80674 WP_000106992.1.80696 WP_000106992.1.80707 WP_000106992.1.80723 WP_000106992.1.80725 WP_000106992.1.80741 WP_000106992.1.80750 WP_000106992.1.80760 WP_000106992.1.80780 WP_000106992.1.80803 WP_000106992.1.80819 WP_000106992.1.80827 WP_000106992.1.80831 WP_000106992.1.80850 WP_000106992.1.80857 WP_000106992.1.80868 WP_000106992.1.80874 WP_000106992.1.80876 WP_000106992.1.80881 WP_000106992.1.80913 WP_000106992.1.80927 WP_000106992.1.80939 WP_000106992.1.80959 WP_000106992.1.8096 WP_000106992.1.80973 WP_000106992.1.80984 WP_000106992.1.81037 WP_000106992.1.8106 WP_000106992.1.81062 WP_000106992.1.81067 WP_000106992.1.81069 WP_000106992.1.81107 WP_000106992.1.81109 WP_000106992.1.81110 WP_000106992.1.81118 WP_000106992.1.81131 WP_000106992.1.81149 WP_000106992.1.81175 WP_000106992.1.81187 WP_000106992.1.8119 WP_000106992.1.81193 WP_000106992.1.81197 WP_000106992.1.81225 WP_000106992.1.81231 WP_000106992.1.81262 WP_000106992.1.81268 WP_000106992.1.81269 WP_000106992.1.8127 WP_000106992.1.81271 WP_000106992.1.81275 WP_000106992.1.8130 WP_000106992.1.81302 WP_000106992.1.81305 WP_000106992.1.8131 WP_000106992.1.81320 WP_000106992.1.81321 WP_000106992.1.81328 WP_000106992.1.81333 WP_000106992.1.8134 WP_000106992.1.81342 WP_000106992.1.81354 WP_000106992.1.81364 WP_000106992.1.81388 WP_000106992.1.81404 WP_000106992.1.81409 WP_000106992.1.81425 WP_000106992.1.81455 WP_000106992.1.81472 WP_000106992.1.81494 WP_000106992.1.81504 WP_000106992.1.81528 WP_000106992.1.81548 WP_000106992.1.81557 WP_000106992.1.81667 WP_000106992.1.81668 WP_000106992.1.81676 WP_000106992.1.8168 WP_000106992.1.81681 WP_000106992.1.8170 WP_000106992.1.81727 WP_000106992.1.81735 WP_000106992.1.81736 WP_000106992.1.81743 WP_000106992.1.81746 WP_000106992.1.81750 WP_000106992.1.81760 WP_000106992.1.81763 WP_000106992.1.81768 WP_000106992.1.81785 WP_000106992.1.81795 WP_000106992.1.81855 WP_000106992.1.81921 WP_000106992.1.81931 WP_000106992.1.81936 WP_000106992.1.81941 WP_000106992.1.81949 WP_000106992.1.8196 WP_000106992.1.81965 WP_000106992.1.81974 WP_000106992.1.81977 WP_000106992.1.81995 WP_000106992.1.82037 WP_000106992.1.82070 WP_000106992.1.82076 WP_000106992.1.82099 WP_000106992.1.82131 WP_000106992.1.82141 WP_000106992.1.82144 WP_000106992.1.82149 WP_000106992.1.82156 WP_000106992.1.8218 WP_000106992.1.82180 WP_000106992.1.82192 WP_000106992.1.82201 WP_000106992.1.82214 WP_000106992.1.82225 WP_000106992.1.82232 WP_000106992.1.82258 WP_000106992.1.82269 WP_000106992.1.82337 WP_000106992.1.82347 WP_000106992.1.82352 WP_000106992.1.8236 WP_000106992.1.82369 WP_000106992.1.82395 WP_000106992.1.8240 WP_000106992.1.82401 WP_000106992.1.82408 WP_000106992.1.82416 WP_000106992.1.8242 WP_000106992.1.82420 WP_000106992.1.82434 WP_000106992.1.82456 WP_000106992.1.82464 WP_000106992.1.82465 WP_000106992.1.8247 WP_000106992.1.82473 WP_000106992.1.82474 WP_000106992.1.82479 WP_000106992.1.82503 WP_000106992.1.82515 WP_000106992.1.82529 WP_000106992.1.82530 WP_000106992.1.82553 WP_000106992.1.82562 WP_000106992.1.82569 WP_000106992.1.82570 WP_000106992.1.82584 WP_000106992.1.82636 WP_000106992.1.82637 WP_000106992.1.82646 WP_000106992.1.82648 WP_000106992.1.82670 WP_000106992.1.82676 WP_000106992.1.82731 WP_000106992.1.82761 WP_000106992.1.82763 WP_000106992.1.82812 WP_000106992.1.8282 WP_000106992.1.82841 WP_000106992.1.82843 WP_000106992.1.82850 WP_000106992.1.82867 WP_000106992.1.82872 WP_000106992.1.82886 WP_000106992.1.82895 WP_000106992.1.82899 WP_000106992.1.82908 WP_000106992.1.8294 WP_000106992.1.82944 WP_000106992.1.82946 WP_000106992.1.82956 WP_000106992.1.82959 WP_000106992.1.82964 WP_000106992.1.82992 WP_000106992.1.83005 WP_000106992.1.83006 WP_000106992.1.83007 WP_000106992.1.8304 WP_000106992.1.83061 WP_000106992.1.83092 WP_000106992.1.83119 WP_000106992.1.83128 WP_000106992.1.83163 WP_000106992.1.83180 WP_000106992.1.83204 WP_000106992.1.8322 WP_000106992.1.83221 WP_000106992.1.83229 WP_000106992.1.83235 WP_000106992.1.83247 WP_000106992.1.83252 WP_000106992.1.83258 WP_000106992.1.83290 WP_000106992.1.83301 WP_000106992.1.83305 WP_000106992.1.83331 WP_000106992.1.83333 WP_000106992.1.83354 WP_000106992.1.83356 WP_000106992.1.83360 WP_000106992.1.83378 WP_000106992.1.83382 WP_000106992.1.83388 WP_000106992.1.83407 WP_000106992.1.83413 WP_000106992.1.83491 WP_000106992.1.83516 WP_000106992.1.83523 WP_000106992.1.8354 WP_000106992.1.83558 WP_000106992.1.83572 WP_000106992.1.83650 WP_000106992.1.83651 WP_000106992.1.83657 WP_000106992.1.83677 WP_000106992.1.83710 WP_000106992.1.83721 WP_000106992.1.83739 WP_000106992.1.8375 WP_000106992.1.83759 WP_000106992.1.83760 WP_000106992.1.83854 WP_000106992.1.83897 WP_000106992.1.83923 WP_000106992.1.83960 WP_000106992.1.83979 WP_000106992.1.8399 WP_000106992.1.83994 WP_000106992.1.83995 WP_000106992.1.84 WP_000106992.1.84000 WP_000106992.1.84001 WP_000106992.1.84011 WP_000106992.1.8406 WP_000106992.1.84075 WP_000106992.1.84076 WP_000106992.1.84077 WP_000106992.1.84083 WP_000106992.1.84086 WP_000106992.1.84100 WP_000106992.1.84103 WP_000106992.1.84106 WP_000106992.1.84110 WP_000106992.1.84115 WP_000106992.1.84127 WP_000106992.1.84150 WP_000106992.1.84154 WP_000106992.1.84168 WP_000106992.1.84198 WP_000106992.1.84205 WP_000106992.1.84209 WP_000106992.1.84229 WP_000106992.1.84230 WP_000106992.1.8425 WP_000106992.1.84252 WP_000106992.1.84283 WP_000106992.1.84291 WP_000106992.1.84300 WP_000106992.1.8431 WP_000106992.1.84325 WP_000106992.1.84345 WP_000106992.1.84355 WP_000106992.1.84359 WP_000106992.1.84369 WP_000106992.1.84373 WP_000106992.1.84392 WP_000106992.1.84397 WP_000106992.1.84401 WP_000106992.1.84403 WP_000106992.1.8441 WP_000106992.1.84435 WP_000106992.1.84459 WP_000106992.1.84461 WP_000106992.1.84475 WP_000106992.1.84497 WP_000106992.1.84515 WP_000106992.1.84523 WP_000106992.1.84532 WP_000106992.1.84551 WP_000106992.1.84554 WP_000106992.1.84567 WP_000106992.1.84572 WP_000106992.1.84598 WP_000106992.1.84631 WP_000106992.1.84644 WP_000106992.1.84659 WP_000106992.1.84683 WP_000106992.1.84711 WP_000106992.1.84721 WP_000106992.1.84727 WP_000106992.1.84744 WP_000106992.1.84745 WP_000106992.1.84773 WP_000106992.1.84876 WP_000106992.1.84899 WP_000106992.1.849 WP_000106992.1.84945 WP_000106992.1.84967 WP_000106992.1.8497 WP_000106992.1.84983 WP_000106992.1.850 WP_000106992.1.85004 WP_000106992.1.85014 WP_000106992.1.8502 WP_000106992.1.85031 WP_000106992.1.85039 WP_000106992.1.85040 WP_000106992.1.85079 WP_000106992.1.85094 WP_000106992.1.85120 WP_000106992.1.85134 WP_000106992.1.85147 WP_000106992.1.85153 WP_000106992.1.85178 WP_000106992.1.85180 WP_000106992.1.85190 WP_000106992.1.85192 WP_000106992.1.85217 WP_000106992.1.8526 WP_000106992.1.85271 WP_000106992.1.85273 WP_000106992.1.85301 WP_000106992.1.8533 WP_000106992.1.85338 WP_000106992.1.85339 WP_000106992.1.8537 WP_000106992.1.85408 WP_000106992.1.85433 WP_000106992.1.8545 WP_000106992.1.85456 WP_000106992.1.85469 WP_000106992.1.85481 WP_000106992.1.85483 WP_000106992.1.85511 WP_000106992.1.85512 WP_000106992.1.8552 WP_000106992.1.85541 WP_000106992.1.8556 WP_000106992.1.85568 WP_000106992.1.8557 WP_000106992.1.85606 WP_000106992.1.85615 WP_000106992.1.85617 WP_000106992.1.85635 WP_000106992.1.85646 WP_000106992.1.85654 WP_000106992.1.85663 WP_000106992.1.85665 WP_000106992.1.85669 WP_000106992.1.85671 WP_000106992.1.85675 WP_000106992.1.85688 WP_000106992.1.85703 WP_000106992.1.85723 WP_000106992.1.85728 WP_000106992.1.85742 WP_000106992.1.85746 WP_000106992.1.85759 WP_000106992.1.85777 WP_000106992.1.85780 WP_000106992.1.85784 WP_000106992.1.85797 WP_000106992.1.85811 WP_000106992.1.85854 WP_000106992.1.85864 WP_000106992.1.85886 WP_000106992.1.859 WP_000106992.1.85900 WP_000106992.1.85904 WP_000106992.1.8591 WP_000106992.1.85917 WP_000106992.1.8594 WP_000106992.1.85943 WP_000106992.1.85977 WP_000106992.1.85982 WP_000106992.1.860 WP_000106992.1.86007 WP_000106992.1.86010 WP_000106992.1.86017 WP_000106992.1.86043 WP_000106992.1.8605 WP_000106992.1.86084 WP_000106992.1.86092 WP_000106992.1.8610 WP_000106992.1.86120 WP_000106992.1.86126 WP_000106992.1.86138 WP_000106992.1.8614 WP_000106992.1.86156 WP_000106992.1.86157 WP_000106992.1.86159 WP_000106992.1.8616 WP_000106992.1.86173 WP_000106992.1.86206 WP_000106992.1.86224 WP_000106992.1.86240 WP_000106992.1.86284 WP_000106992.1.86285 WP_000106992.1.86306 WP_000106992.1.86310 WP_000106992.1.86323 WP_000106992.1.86335 WP_000106992.1.86342 WP_000106992.1.86347 WP_000106992.1.86356 WP_000106992.1.86380 WP_000106992.1.86389 WP_000106992.1.8640 WP_000106992.1.8642 WP_000106992.1.86426 WP_000106992.1.86442 WP_000106992.1.86450 WP_000106992.1.86453 WP_000106992.1.86469 WP_000106992.1.8647 WP_000106992.1.86489 WP_000106992.1.86514 WP_000106992.1.86530 WP_000106992.1.86580 WP_000106992.1.86588 WP_000106992.1.86593 WP_000106992.1.86601 WP_000106992.1.86610 WP_000106992.1.86634 WP_000106992.1.86656 WP_000106992.1.86658 WP_000106992.1.86661 WP_000106992.1.86663 WP_000106992.1.86676 WP_000106992.1.86699 WP_000106992.1.8671 WP_000106992.1.8672 WP_000106992.1.86735 WP_000106992.1.86744 WP_000106992.1.86770 WP_000106992.1.8678 WP_000106992.1.86794 WP_000106992.1.86800 WP_000106992.1.86807 WP_000106992.1.86810 WP_000106992.1.86811 WP_000106992.1.86815 WP_000106992.1.8684 WP_000106992.1.86859 WP_000106992.1.86860 WP_000106992.1.86895 WP_000106992.1.86902 WP_000106992.1.86906 WP_000106992.1.8691 WP_000106992.1.86915 WP_000106992.1.86921 WP_000106992.1.86945 WP_000106992.1.86982 WP_000106992.1.86989 WP_000106992.1.87023 WP_000106992.1.87034 WP_000106992.1.87038 WP_000106992.1.87041 WP_000106992.1.87051 WP_000106992.1.87095 WP_000106992.1.87136 WP_000106992.1.87143 WP_000106992.1.87148 WP_000106992.1.87155 WP_000106992.1.87187 WP_000106992.1.87219 WP_000106992.1.8722 WP_000106992.1.87258 WP_000106992.1.87282 WP_000106992.1.87283 WP_000106992.1.87293 WP_000106992.1.87323 WP_000106992.1.87346 WP_000106992.1.8736 WP_000106992.1.87365 WP_000106992.1.87370 WP_000106992.1.87420 WP_000106992.1.87460 WP_000106992.1.87484 WP_000106992.1.87493 WP_000106992.1.87500 WP_000106992.1.87528 WP_000106992.1.87552 WP_000106992.1.87560 WP_000106992.1.87583 WP_000106992.1.87584 WP_000106992.1.8760 WP_000106992.1.87600 WP_000106992.1.87609 WP_000106992.1.87612 WP_000106992.1.87615 WP_000106992.1.87618 WP_000106992.1.87626 WP_000106992.1.87653 WP_000106992.1.87659 WP_000106992.1.8767 WP_000106992.1.87687 WP_000106992.1.87695 WP_000106992.1.87698 WP_000106992.1.87706 WP_000106992.1.87712 WP_000106992.1.87739 WP_000106992.1.87741 WP_000106992.1.87742 WP_000106992.1.87760 WP_000106992.1.87779 WP_000106992.1.87813 WP_000106992.1.87852 WP_000106992.1.87875 WP_000106992.1.87899 WP_000106992.1.87905 WP_000106992.1.8792 WP_000106992.1.87933 WP_000106992.1.87936 WP_000106992.1.87945 WP_000106992.1.87949 WP_000106992.1.8800 WP_000106992.1.88014 WP_000106992.1.88019 WP_000106992.1.88025 WP_000106992.1.88026 WP_000106992.1.8805 WP_000106992.1.88052 WP_000106992.1.8806 WP_000106992.1.88073 WP_000106992.1.8809 WP_000106992.1.88092 WP_000106992.1.881 WP_000106992.1.88136 WP_000106992.1.88145 WP_000106992.1.88165 WP_000106992.1.88174 WP_000106992.1.88185 WP_000106992.1.88199 WP_000106992.1.88214 WP_000106992.1.88222 WP_000106992.1.88275 WP_000106992.1.88293 WP_000106992.1.88299 WP_000106992.1.88303 WP_000106992.1.88313 WP_000106992.1.88356 WP_000106992.1.88359 WP_000106992.1.8837 WP_000106992.1.88393 WP_000106992.1.88407 WP_000106992.1.88414 WP_000106992.1.88423 WP_000106992.1.88444 WP_000106992.1.88446 WP_000106992.1.88458 WP_000106992.1.88474 WP_000106992.1.88483 WP_000106992.1.8849 WP_000106992.1.88501 WP_000106992.1.88508 WP_000106992.1.88538 WP_000106992.1.88547 WP_000106992.1.88597 WP_000106992.1.886 WP_000106992.1.88609 WP_000106992.1.88620 WP_000106992.1.88624 WP_000106992.1.88647 WP_000106992.1.88648 WP_000106992.1.88651 WP_000106992.1.88675 WP_000106992.1.88683 WP_000106992.1.88692 WP_000106992.1.88698 WP_000106992.1.88703 WP_000106992.1.88707 WP_000106992.1.88727 WP_000106992.1.88731 WP_000106992.1.88762 WP_000106992.1.88772 WP_000106992.1.88776 WP_000106992.1.88792 WP_000106992.1.88845 WP_000106992.1.88850 WP_000106992.1.88854 WP_000106992.1.8889 WP_000106992.1.88892 WP_000106992.1.88894 WP_000106992.1.88902 WP_000106992.1.8891 WP_000106992.1.88942 WP_000106992.1.88957 WP_000106992.1.88966 WP_000106992.1.88967 WP_000106992.1.88968 WP_000106992.1.88970 WP_000106992.1.88980 WP_000106992.1.88981 WP_000106992.1.88982 WP_000106992.1.88995 WP_000106992.1.88998 WP_000106992.1.89008 WP_000106992.1.89054 WP_000106992.1.89114 WP_000106992.1.89116 WP_000106992.1.89119 WP_000106992.1.89120 WP_000106992.1.89138 WP_000106992.1.89174 WP_000106992.1.89177 WP_000106992.1.89182 WP_000106992.1.89188 WP_000106992.1.89215 WP_000106992.1.89221 WP_000106992.1.89291 WP_000106992.1.89298 WP_000106992.1.89304 WP_000106992.1.89308 WP_000106992.1.89311 WP_000106992.1.89314 WP_000106992.1.89328 WP_000106992.1.89332 WP_000106992.1.89343 WP_000106992.1.89354 WP_000106992.1.89355 WP_000106992.1.89362 WP_000106992.1.89395 WP_000106992.1.8940 WP_000106992.1.89408 WP_000106992.1.89425 WP_000106992.1.89449 WP_000106992.1.89452 WP_000106992.1.89462 WP_000106992.1.8947 WP_000106992.1.89503 WP_000106992.1.89512 WP_000106992.1.89527 WP_000106992.1.89570 WP_000106992.1.8958 WP_000106992.1.89580 WP_000106992.1.89591 WP_000106992.1.89604 WP_000106992.1.89606 WP_000106992.1.8961 WP_000106992.1.89612 WP_000106992.1.89622 WP_000106992.1.89632 WP_000106992.1.89634 WP_000106992.1.89647 WP_000106992.1.89657 WP_000106992.1.89659 WP_000106992.1.89668 WP_000106992.1.89680 WP_000106992.1.89706 WP_000106992.1.89713 WP_000106992.1.89733 WP_000106992.1.89746 WP_000106992.1.89765 WP_000106992.1.89777 WP_000106992.1.89789 WP_000106992.1.89796 WP_000106992.1.89804 WP_000106992.1.89815 WP_000106992.1.89817 WP_000106992.1.89832 WP_000106992.1.89845 WP_000106992.1.89870 WP_000106992.1.89888 WP_000106992.1.89902 WP_000106992.1.89911 WP_000106992.1.89914 WP_000106992.1.89940 WP_000106992.1.8995 WP_000106992.1.89952 WP_000106992.1.8996 WP_000106992.1.89965 WP_000106992.1.90007 WP_000106992.1.9002 WP_000106992.1.9003 WP_000106992.1.90033 WP_000106992.1.90084 WP_000106992.1.90097 WP_000106992.1.90108 WP_000106992.1.9011 WP_000106992.1.90193 WP_000106992.1.90196 WP_000106992.1.90211 WP_000106992.1.90220 WP_000106992.1.90240 WP_000106992.1.90248 WP_000106992.1.90252 WP_000106992.1.90274 WP_000106992.1.90280 WP_000106992.1.90293 WP_000106992.1.90311 WP_000106992.1.90330 WP_000106992.1.90338 WP_000106992.1.90348 WP_000106992.1.90363 WP_000106992.1.90365 WP_000106992.1.90409 WP_000106992.1.90417 WP_000106992.1.90421 WP_000106992.1.90428 WP_000106992.1.90440 WP_000106992.1.90453 WP_000106992.1.90458 WP_000106992.1.90489 WP_000106992.1.90513 WP_000106992.1.90521 WP_000106992.1.90522 WP_000106992.1.90540 WP_000106992.1.90557 WP_000106992.1.90563 WP_000106992.1.90566 WP_000106992.1.90582 WP_000106992.1.90585 WP_000106992.1.90620 WP_000106992.1.90625 WP_000106992.1.9064 WP_000106992.1.90641 WP_000106992.1.90686 WP_000106992.1.90713 WP_000106992.1.90734 WP_000106992.1.90748 WP_000106992.1.90759 WP_000106992.1.90792 WP_000106992.1.90794 WP_000106992.1.90796 WP_000106992.1.90811 WP_000106992.1.90814 WP_000106992.1.90859 WP_000106992.1.90866 WP_000106992.1.90876 WP_000106992.1.90878 WP_000106992.1.9089 WP_000106992.1.9091 WP_000106992.1.9093 WP_000106992.1.90959 WP_000106992.1.90973 WP_000106992.1.90983 WP_000106992.1.90984 WP_000106992.1.90991 WP_000106992.1.91003 WP_000106992.1.91023 WP_000106992.1.91042 WP_000106992.1.91049 WP_000106992.1.91056 WP_000106992.1.91067 WP_000106992.1.91069 WP_000106992.1.91107 WP_000106992.1.91156 WP_000106992.1.91164 WP_000106992.1.91179 WP_000106992.1.91189 WP_000106992.1.91205 WP_000106992.1.91215 WP_000106992.1.91239 WP_000106992.1.91278 WP_000106992.1.91291 WP_000106992.1.91313 WP_000106992.1.91334 WP_000106992.1.9135 WP_000106992.1.9137 WP_000106992.1.91372 WP_000106992.1.91381 WP_000106992.1.91405 WP_000106992.1.91424 WP_000106992.1.91459 WP_000106992.1.91470 WP_000106992.1.91473 WP_000106992.1.91474 WP_000106992.1.91493 WP_000106992.1.91505 WP_000106992.1.91506 WP_000106992.1.91512 WP_000106992.1.91524 WP_000106992.1.91528 WP_000106992.1.91557 WP_000106992.1.91564 WP_000106992.1.91580 WP_000106992.1.91597 WP_000106992.1.91621 WP_000106992.1.91625 WP_000106992.1.91628 WP_000106992.1.91655 WP_000106992.1.91702 WP_000106992.1.91715 WP_000106992.1.91724 WP_000106992.1.91732 WP_000106992.1.91736 WP_000106992.1.91742 WP_000106992.1.91772 WP_000106992.1.91776 WP_000106992.1.91788 WP_000106992.1.91795 WP_000106992.1.91864 WP_000106992.1.9187 WP_000106992.1.91870 WP_000106992.1.91898 WP_000106992.1.91903 WP_000106992.1.91904 WP_000106992.1.91914 WP_000106992.1.91974 WP_000106992.1.92013 WP_000106992.1.92018 WP_000106992.1.92039 WP_000106992.1.92044 WP_000106992.1.92047 WP_000106992.1.92067 WP_000106992.1.92068 WP_000106992.1.92082 WP_000106992.1.92087 WP_000106992.1.92093 WP_000106992.1.92098 WP_000106992.1.92099 WP_000106992.1.92108 WP_000106992.1.92122 WP_000106992.1.92129 WP_000106992.1.92149 WP_000106992.1.92156 WP_000106992.1.92165 WP_000106992.1.92172 WP_000106992.1.92183 WP_000106992.1.92208 WP_000106992.1.92213 WP_000106992.1.9222 WP_000106992.1.92240 WP_000106992.1.92243 WP_000106992.1.92268 WP_000106992.1.92270 WP_000106992.1.92299 WP_000106992.1.92310 WP_000106992.1.92318 WP_000106992.1.92327 WP_000106992.1.92375 WP_000106992.1.92394 WP_000106992.1.92399 WP_000106992.1.92408 WP_000106992.1.92411 WP_000106992.1.92439 WP_000106992.1.92443 WP_000106992.1.92452 WP_000106992.1.92470 WP_000106992.1.92477 WP_000106992.1.92482 WP_000106992.1.92529 WP_000106992.1.9253 WP_000106992.1.92531 WP_000106992.1.92545 WP_000106992.1.92557 WP_000106992.1.92562 WP_000106992.1.92570 WP_000106992.1.92575 WP_000106992.1.92588 WP_000106992.1.926 WP_000106992.1.92628 WP_000106992.1.92633 WP_000106992.1.92649 WP_000106992.1.92669 WP_000106992.1.92671 WP_000106992.1.92676 WP_000106992.1.92705 WP_000106992.1.9271 WP_000106992.1.92729 WP_000106992.1.92734 WP_000106992.1.92738 WP_000106992.1.92754 WP_000106992.1.92758 WP_000106992.1.92806 WP_000106992.1.92810 WP_000106992.1.92823 WP_000106992.1.92827 WP_000106992.1.92832 WP_000106992.1.92836 WP_000106992.1.92843 WP_000106992.1.92875 WP_000106992.1.92879 WP_000106992.1.92890 WP_000106992.1.92893 WP_000106992.1.92895 WP_000106992.1.92926 WP_000106992.1.92929 WP_000106992.1.92947 WP_000106992.1.92975 WP_000106992.1.92987 WP_000106992.1.92988 WP_000106992.1.93007 WP_000106992.1.93022 WP_000106992.1.93059 WP_000106992.1.93061 WP_000106992.1.93076 WP_000106992.1.93086 WP_000106992.1.93101 WP_000106992.1.93103 WP_000106992.1.93105 WP_000106992.1.93111 WP_000106992.1.93121 WP_000106992.1.93136 WP_000106992.1.93155 WP_000106992.1.93168 WP_000106992.1.93184 WP_000106992.1.93213 WP_000106992.1.93215 WP_000106992.1.93221 WP_000106992.1.93223 WP_000106992.1.93239 WP_000106992.1.93302 WP_000106992.1.93322 WP_000106992.1.93339 WP_000106992.1.93350 WP_000106992.1.9336 WP_000106992.1.93365 WP_000106992.1.93387 WP_000106992.1.93410 WP_000106992.1.93469 WP_000106992.1.93511 WP_000106992.1.93512 WP_000106992.1.93524 WP_000106992.1.93543 WP_000106992.1.93577 WP_000106992.1.93596 WP_000106992.1.93604 WP_000106992.1.93635 WP_000106992.1.93648 WP_000106992.1.93650 WP_000106992.1.93656 WP_000106992.1.93657 WP_000106992.1.93662 WP_000106992.1.93671 WP_000106992.1.93691 WP_000106992.1.937 WP_000106992.1.93705 WP_000106992.1.9374 WP_000106992.1.93741 WP_000106992.1.9375 WP_000106992.1.93754 WP_000106992.1.93761 WP_000106992.1.93767 WP_000106992.1.93780 WP_000106992.1.9380 WP_000106992.1.93803 WP_000106992.1.93804 WP_000106992.1.93809 WP_000106992.1.93828 WP_000106992.1.93837 WP_000106992.1.93842 WP_000106992.1.93843 WP_000106992.1.93875 WP_000106992.1.9389 WP_000106992.1.93909 WP_000106992.1.93919 WP_000106992.1.93937 WP_000106992.1.93938 WP_000106992.1.93956 WP_000106992.1.93984 WP_000106992.1.93986 WP_000106992.1.9399 WP_000106992.1.93994 WP_000106992.1.94017 WP_000106992.1.94039 WP_000106992.1.94056 WP_000106992.1.94064 WP_000106992.1.94070 WP_000106992.1.94072 WP_000106992.1.94079 WP_000106992.1.94097 WP_000106992.1.94107 WP_000106992.1.94142 WP_000106992.1.94162 WP_000106992.1.94167 WP_000106992.1.94168 WP_000106992.1.94181 WP_000106992.1.94198 WP_000106992.1.94215 WP_000106992.1.94303 WP_000106992.1.9432 WP_000106992.1.94352 WP_000106992.1.94354 WP_000106992.1.94365 WP_000106992.1.94379 WP_000106992.1.94380 WP_000106992.1.94383 WP_000106992.1.94390 WP_000106992.1.9440 WP_000106992.1.94412 WP_000106992.1.94415 WP_000106992.1.94458 WP_000106992.1.94473 WP_000106992.1.94492 WP_000106992.1.94510 WP_000106992.1.94527 WP_000106992.1.94557 WP_000106992.1.94562 WP_000106992.1.94565 WP_000106992.1.94573 WP_000106992.1.94579 WP_000106992.1.94584 WP_000106992.1.94586 WP_000106992.1.94588 WP_000106992.1.94593 WP_000106992.1.94598 WP_000106992.1.94622 WP_000106992.1.94649 WP_000106992.1.94650 WP_000106992.1.94655 WP_000106992.1.94659 WP_000106992.1.94662 WP_000106992.1.94669 WP_000106992.1.94670 WP_000106992.1.94674 WP_000106992.1.94700 WP_000106992.1.94717 WP_000106992.1.94722 WP_000106992.1.94745 WP_000106992.1.94782 WP_000106992.1.94785 WP_000106992.1.94796 WP_000106992.1.94798 WP_000106992.1.9481 WP_000106992.1.94815 WP_000106992.1.94820 WP_000106992.1.94835 WP_000106992.1.94849 WP_000106992.1.94850 WP_000106992.1.94851 WP_000106992.1.94862 WP_000106992.1.94864 WP_000106992.1.94947 WP_000106992.1.94952 WP_000106992.1.94959 WP_000106992.1.94967 WP_000106992.1.94971 WP_000106992.1.94982 WP_000106992.1.94983 WP_000106992.1.94986 WP_000106992.1.94987 WP_000106992.1.95006 WP_000106992.1.9503 WP_000106992.1.95051 WP_000106992.1.95055 WP_000106992.1.95076 WP_000106992.1.95085 WP_000106992.1.95094 WP_000106992.1.95099 WP_000106992.1.95121 WP_000106992.1.95136 WP_000106992.1.95152 WP_000106992.1.9516 WP_000106992.1.95165 WP_000106992.1.95171 WP_000106992.1.95235 WP_000106992.1.95239 WP_000106992.1.95246 WP_000106992.1.95248 WP_000106992.1.95249 WP_000106992.1.9525 WP_000106992.1.95255 WP_000106992.1.95265 WP_000106992.1.9527 WP_000106992.1.95277 WP_000106992.1.95282 WP_000106992.1.95289 WP_000106992.1.95298 WP_000106992.1.9530 WP_000106992.1.95320 WP_000106992.1.95338 WP_000106992.1.95388 WP_000106992.1.95404 WP_000106992.1.95412 WP_000106992.1.95434 WP_000106992.1.95447 WP_000106992.1.95456 WP_000106992.1.95530 WP_000106992.1.95546 WP_000106992.1.95547 WP_000106992.1.95558 WP_000106992.1.95579 WP_000106992.1.95590 WP_000106992.1.95607 WP_000106992.1.95623 WP_000106992.1.95625 WP_000106992.1.95630 WP_000106992.1.95656 WP_000106992.1.95670 WP_000106992.1.95675 WP_000106992.1.95691 WP_000106992.1.95701 WP_000106992.1.95703 WP_000106992.1.95716 WP_000106992.1.95729 WP_000106992.1.9574 WP_000106992.1.95744 WP_000106992.1.95757 WP_000106992.1.95776 WP_000106992.1.95803 WP_000106992.1.95805 WP_000106992.1.95826 WP_000106992.1.95840 WP_000106992.1.9586 WP_000106992.1.95866 WP_000106992.1.95884 WP_000106992.1.95890 WP_000106992.1.95906 WP_000106992.1.95911 WP_000106992.1.95939 WP_000106992.1.95963 WP_000106992.1.96004 WP_000106992.1.96025 WP_000106992.1.96042 WP_000106992.1.96044 WP_000106992.1.96045 WP_000106992.1.96054 WP_000106992.1.9609 WP_000106992.1.96094 WP_000106992.1.96107 WP_000106992.1.96127 WP_000106992.1.96139 WP_000106992.1.96144 WP_000106992.1.96162 WP_000106992.1.96172 WP_000106992.1.96188 WP_000106992.1.96190 WP_000106992.1.96203 WP_000106992.1.96206 WP_000106992.1.96211 WP_000106992.1.96212 WP_000106992.1.9624 WP_000106992.1.96260 WP_000106992.1.9627 WP_000106992.1.96317 WP_000106992.1.96319 WP_000106992.1.9633 WP_000106992.1.96335 WP_000106992.1.96340 WP_000106992.1.96343 WP_000106992.1.96348 WP_000106992.1.96349 WP_000106992.1.96359 WP_000106992.1.96380 WP_000106992.1.96404 WP_000106992.1.96429 WP_000106992.1.9644 WP_000106992.1.96469 WP_000106992.1.96490 WP_000106992.1.96497 WP_000106992.1.96500 WP_000106992.1.96521 WP_000106992.1.96533 WP_000106992.1.96537 WP_000106992.1.96539 WP_000106992.1.96552 WP_000106992.1.96555 WP_000106992.1.96563 WP_000106992.1.96584 WP_000106992.1.96588 WP_000106992.1.96590 WP_000106992.1.96600 WP_000106992.1.96610 WP_000106992.1.96625 WP_000106992.1.9664 WP_000106992.1.96640 WP_000106992.1.96642 WP_000106992.1.96662 WP_000106992.1.96675 WP_000106992.1.9670 WP_000106992.1.96721 WP_000106992.1.96732 WP_000106992.1.96735 WP_000106992.1.9674 WP_000106992.1.96750 WP_000106992.1.96758 WP_000106992.1.96761 WP_000106992.1.96771 WP_000106992.1.96792 WP_000106992.1.96798 WP_000106992.1.96801 WP_000106992.1.96803 WP_000106992.1.96810 WP_000106992.1.9686 WP_000106992.1.96876 WP_000106992.1.96890 WP_000106992.1.96902 WP_000106992.1.96917 WP_000106992.1.96925 WP_000106992.1.96938 WP_000106992.1.96946 WP_000106992.1.96957 WP_000106992.1.96978 WP_000106992.1.96993 WP_000106992.1.97005 WP_000106992.1.97015 WP_000106992.1.97026 WP_000106992.1.97028 WP_000106992.1.97043 WP_000106992.1.97047 WP_000106992.1.97079 WP_000106992.1.97089 WP_000106992.1.97103 WP_000106992.1.97143 WP_000106992.1.97145 WP_000106992.1.97154 WP_000106992.1.97184 WP_000106992.1.97185 WP_000106992.1.97190 WP_000106992.1.97224 WP_000106992.1.97260 WP_000106992.1.97287 WP_000106992.1.97291 WP_000106992.1.97297 WP_000106992.1.97318 WP_000106992.1.97322 WP_000106992.1.97328 WP_000106992.1.97368 WP_000106992.1.97369 WP_000106992.1.97386 WP_000106992.1.97413 WP_000106992.1.97422 WP_000106992.1.97441 WP_000106992.1.97477 WP_000106992.1.97480 WP_000106992.1.97487 WP_000106992.1.97496 WP_000106992.1.97497 WP_000106992.1.97505 WP_000106992.1.97534 WP_000106992.1.97547 WP_000106992.1.97594 WP_000106992.1.97597 WP_000106992.1.97599 WP_000106992.1.97606 WP_000106992.1.97613 WP_000106992.1.97615 WP_000106992.1.97620 WP_000106992.1.97626 WP_000106992.1.97628 WP_000106992.1.97631 WP_000106992.1.97640 WP_000106992.1.97646 WP_000106992.1.97648 WP_000106992.1.97656 WP_000106992.1.97690 WP_000106992.1.97691 WP_000106992.1.97693 WP_000106992.1.97704 WP_000106992.1.97725 WP_000106992.1.97726 WP_000106992.1.97727 WP_000106992.1.97732 WP_000106992.1.97736 WP_000106992.1.9774 WP_000106992.1.9775 WP_000106992.1.97768 WP_000106992.1.97819 WP_000106992.1.97840 WP_000106992.1.97846 WP_000106992.1.97873 WP_000106992.1.9793 WP_000106992.1.97938 WP_000106992.1.97981 WP_000106992.1.97983 WP_000106992.1.97986 WP_000106992.1.9799 WP_000106992.1.97991 WP_000106992.1.98006 WP_000106992.1.98019 WP_000106992.1.98022 WP_000106992.1.98036 WP_000106992.1.9805 WP_000106992.1.98080 WP_000106992.1.98086 WP_000106992.1.98107 WP_000106992.1.9811 WP_000106992.1.98110 WP_000106992.1.98119 WP_000106992.1.98124 WP_000106992.1.98146 WP_000106992.1.98158 WP_000106992.1.98170 WP_000106992.1.98201 WP_000106992.1.98219 WP_000106992.1.98236 WP_000106992.1.98250 WP_000106992.1.9826 WP_000106992.1.98263 WP_000106992.1.98314 WP_000106992.1.98338 WP_000106992.1.98392 WP_000106992.1.98402 WP_000106992.1.98403 WP_000106992.1.9841 WP_000106992.1.98418 WP_000106992.1.98438 WP_000106992.1.98440 WP_000106992.1.98446 WP_000106992.1.98448 WP_000106992.1.98457 WP_000106992.1.98472 WP_000106992.1.98483 WP_000106992.1.98495 WP_000106992.1.9850 WP_000106992.1.98502 WP_000106992.1.98513 WP_000106992.1.98531 WP_000106992.1.98551 WP_000106992.1.98570 WP_000106992.1.98577 WP_000106992.1.98607 WP_000106992.1.98608 WP_000106992.1.98627 WP_000106992.1.9863 WP_000106992.1.98634 WP_000106992.1.98676 WP_000106992.1.98677 WP_000106992.1.98726 WP_000106992.1.98731 WP_000106992.1.98751 WP_000106992.1.98760 WP_000106992.1.98762 WP_000106992.1.98763 WP_000106992.1.9877 WP_000106992.1.98779 WP_000106992.1.98801 WP_000106992.1.98818 WP_000106992.1.98843 WP_000106992.1.9887 WP_000106992.1.98899 WP_000106992.1.98931 WP_000106992.1.98947 WP_000106992.1.9898 WP_000106992.1.9899 WP_000106992.1.99040 WP_000106992.1.99057 WP_000106992.1.99071 WP_000106992.1.99072 WP_000106992.1.99083 WP_000106992.1.99097 WP_000106992.1.99098 WP_000106992.1.99107 WP_000106992.1.99163 WP_000106992.1.99164 WP_000106992.1.99184 WP_000106992.1.99197 WP_000106992.1.99198 WP_000106992.1.99215 WP_000106992.1.99219 WP_000106992.1.99255 WP_000106992.1.99267 WP_000106992.1.99276 WP_000106992.1.99278 WP_000106992.1.99327 WP_000106992.1.99335 WP_000106992.1.99339 WP_000106992.1.99350 WP_000106992.1.99360 WP_000106992.1.99363 WP_000106992.1.99369 WP_000106992.1.99370 WP_000106992.1.99388 WP_000106992.1.99397 WP_000106992.1.99456 WP_000106992.1.99463 WP_000106992.1.99469 WP_000106992.1.99483 WP_000106992.1.99490 WP_000106992.1.99493 WP_000106992.1.99546 WP_000106992.1.99561 WP_000106992.1.99577 WP_000106992.1.99579 WP_000106992.1.99595 WP_000106992.1.99613 WP_000106992.1.99626 WP_000106992.1.99630 WP_000106992.1.99637 WP_000106992.1.99646 WP_000106992.1.99657 WP_000106992.1.99660 WP_000106992.1.99671 WP_000106992.1.99676 WP_000106992.1.99712 WP_000106992.1.99725 WP_000106992.1.99747 WP_000106992.1.99764 WP_000106992.1.99783 WP_000106992.1.99813 WP_000106992.1.99824 WP_000106992.1.99829 WP_000106992.1.99837 WP_000106992.1.99841 WP_000106992.1.99858 WP_000106992.1.99889 WP_000106992.1.9992 WP_000106992.1.99924 WP_000106992.1.99958 WP_000106992.1.99961 WP_000106992.1.99996 AE006468|CDS_4542129-4541197 AE014613|CDS_4371896-4370964 AL513382|CDS_4387246-4386314 AM933172|CDS_4399367-4398435 gi|550903641|ref|YP_008672733.1| gi|29144466|ref|NP_807808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]