SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410023233|ref|YP_006894085.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410023233|ref|YP_006894085.1|
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000212
Family Retroviral integrase, catalytic domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410023233|ref|YP_006894085.1|
Sequence length 93
Comment hypothetical protein STM14_0351 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MLRMDKGPEFISLALAEWAKKHAVKLAFIQPGKPKKNVFITRFNRTYRTEILNSYLFRTL
NEVWEITDKGLSEYNCERPHESRNNMIPKEYRQ
Download sequence
Identical sequences A0A0D6HF27 A0A0F7J3E1 A0A0U1GA34 A0A0W4Z166 A0A2D3ALD6 E8XIW4 G5S6W1 Q8ZRK5
APC24292 gi|379699515|ref|YP_005241243.1| NP_446755.1.58477 WP_001541869.1.101953 WP_001541869.1.14001 WP_001541869.1.4288 WP_001541869.1.44479 WP_001541869.1.4853 WP_001541869.1.52336 WP_001541869.1.63203 WP_001541869.1.63718 WP_001541869.1.68589 WP_001541869.1.74545 WP_001541869.1.88703 WP_001541869.1.92482 WP_001541869.1.94354 gi|482905180|ref|YP_007903740.1| gi|526221974|ref|YP_008264553.1| gi|525841079|ref|YP_008256526.1| gi|410023233|ref|YP_006894085.1| AE006468|CDS_341178-341459 gi|378987700|ref|YP_005250864.1| gi|378982838|ref|YP_005245993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]