SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451227|ref|YP_005238586.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451227|ref|YP_005238586.1|
Domain Number 1 Region: 308-428
Classification Level Classification E-value
Superfamily TPR-like 0.0000000788
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378451227|ref|YP_005238586.1|
Sequence length 487
Comment hypothetical protein STM14_3058 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MFRQLKKNLVATLIAALALGQVAPAFADPADTLPDMGTSAGSTLSIGQEMQMGDFYVRQL
RGSAPLINDPLLVQYINALGMRLVSHADSVKTPFHFFLINNDEINAFAFFGGNVVLHSAL
FRYADNESQLASVMAHEISHVTQRHLARAMEDQKRSAPLTWVGALGSILLAMASPQAGMA
ALTGTLAGTRQGMISFTQQNEQEADRIGIQVLQRAGFDPQAMPSFLEKLLDQARYSTRPP
EILLTHPLPESRLADARNRANQMRPVVVQSSADFYFAKARALGMYNSGRNQLTSDLLDQW
SKGNVRQQHAAQYGRALQAMEASKYDEARKTLQPLLSAEPNNAWYLDLATDIDLGQKRAN
DAINRLKNARDLRVNPVLQLNLANAYLQGGQPKAAETILNRYTFSHKDDGNGWDLLAQAE
AALNNRDQELAARAESYALAGRLDQAISLLSSASAQAKLGSQQQARYDARIDQLRQLQER
FKPYTKM
Download sequence
Identical sequences A0A0D6F9M4 A0A0F6B4P9 A0A0F7J8T8 A0A0G2NPT1 A0A0H3BTG6 A0A0H3NE89 A0A0M0QUN3 A0A0R9NB79 A0A0T7RVM0 A0A0T9W6R2 A0A1S1AJ44 A0A1X2WME9 A0A221YNJ1 A0A221YXE3 A0A249UVY5 A0A265B9D8 A0A2D1XBU9 A0A2D3TTC8 A0A2G1PE23 A0A2H9YAT3 A0A2K2ZRS6 B5RCW6 E8XGI5 P66950 P66951 S5HMW1 V1XD23 V7UY11
gi|378451227|ref|YP_005238586.1| ABAM02000001|CDS_3065729-3067192 ABAN01000002|CDS_143320-141857 ABAO01000009|CDS_75529-76992 ABEI01000009|CDS_76513-77976 ABEL01000007|CDS_74330-75793 ABEW01000008|CDS_149828-148365 ABFF01000001|CDS_22241-20778 ABFG01000004|CDS_126314-124851 AE006468|CDS_2607971-2609434 AE014613|CDS_433162-431699 AL513382|CDS_2571687-2573150 AM933172|CDS_2608855-2610318 AM933173|CDS_2599530-2600993 CP000886|CDS_435101-433638 CP001113|CDS_2608716-2610179 CP001120|CDS_2664494-2665957 CP001144|CDS_2736908-2738371 CP001363|CDS_2659523-2660986 FN424405|CDS_2631639-2633102 NZ_ACBF01000030|CDS_21994-23457 gi|525858465|ref|YP_008261768.1| gi|549725144|ref|YP_008645334.1| gi|194448280|ref|YP_002046557.1| gi|379701725|ref|YP_005243453.1| gi|205353599|ref|YP_002227400.1| gi|386592303|ref|YP_006088703.1| gi|378985054|ref|YP_005248209.1| gi|529219059|ref|YP_008379923.1| gi|378958508|ref|YP_005215994.1| gi|525818390|ref|YP_008248408.1| gi|383497188|ref|YP_005397877.1| gi|198242783|ref|YP_002216563.1| gi|16761412|ref|NP_457029.1| gi|482904306|ref|YP_007902866.1| gi|525946562|ref|YP_008307758.1| gi|526221017|ref|YP_008266738.1| NP_457029.1.84458 NP_461429.1.58477 WP_000489630.1.100002 WP_000489630.1.100008 WP_000489630.1.100010 WP_000489630.1.100017 WP_000489630.1.100031 WP_000489630.1.100036 WP_000489630.1.100077 WP_000489630.1.100079 WP_000489630.1.100115 WP_000489630.1.100129 WP_000489630.1.100149 WP_000489630.1.100191 WP_000489630.1.100196 WP_000489630.1.100234 WP_000489630.1.100258 WP_000489630.1.100284 WP_000489630.1.100288 WP_000489630.1.100313 WP_000489630.1.100314 WP_000489630.1.100321 WP_000489630.1.100354 WP_000489630.1.100376 WP_000489630.1.100392 WP_000489630.1.100412 WP_000489630.1.100421 WP_000489630.1.100424 WP_000489630.1.100432 WP_000489630.1.100436 WP_000489630.1.100438 WP_000489630.1.100446 WP_000489630.1.100450 WP_000489630.1.100457 WP_000489630.1.100472 WP_000489630.1.100484 WP_000489630.1.100488 WP_000489630.1.100502 WP_000489630.1.100521 WP_000489630.1.100541 WP_000489630.1.100557 WP_000489630.1.100584 WP_000489630.1.100589 WP_000489630.1.100592 WP_000489630.1.100597 WP_000489630.1.100605 WP_000489630.1.100610 WP_000489630.1.100650 WP_000489630.1.100707 WP_000489630.1.100711 WP_000489630.1.100730 WP_000489630.1.100732 WP_000489630.1.100733 WP_000489630.1.100739 WP_000489630.1.100750 WP_000489630.1.10076 WP_000489630.1.100764 WP_000489630.1.100776 WP_000489630.1.100781 WP_000489630.1.100793 WP_000489630.1.100799 WP_000489630.1.10081 WP_000489630.1.100857 WP_000489630.1.100865 WP_000489630.1.100869 WP_000489630.1.100870 WP_000489630.1.100871 WP_000489630.1.100882 WP_000489630.1.100895 WP_000489630.1.100941 WP_000489630.1.100944 WP_000489630.1.100948 WP_000489630.1.100953 WP_000489630.1.101007 WP_000489630.1.101011 WP_000489630.1.101020 WP_000489630.1.101042 WP_000489630.1.101074 WP_000489630.1.101078 WP_000489630.1.10108 WP_000489630.1.101091 WP_000489630.1.101112 WP_000489630.1.101123 WP_000489630.1.101126 WP_000489630.1.101180 WP_000489630.1.101223 WP_000489630.1.101226 WP_000489630.1.10124 WP_000489630.1.101259 WP_000489630.1.101271 WP_000489630.1.101284 WP_000489630.1.101291 WP_000489630.1.1013 WP_000489630.1.101312 WP_000489630.1.101322 WP_000489630.1.101353 WP_000489630.1.101374 WP_000489630.1.101386 WP_000489630.1.101404 WP_000489630.1.101420 WP_000489630.1.101454 WP_000489630.1.101519 WP_000489630.1.101520 WP_000489630.1.101541 WP_000489630.1.101589 WP_000489630.1.101612 WP_000489630.1.101616 WP_000489630.1.101634 WP_000489630.1.101636 WP_000489630.1.101674 WP_000489630.1.101707 WP_000489630.1.101724 WP_000489630.1.101734 WP_000489630.1.101741 WP_000489630.1.101744 WP_000489630.1.101759 WP_000489630.1.101815 WP_000489630.1.101832 WP_000489630.1.101839 WP_000489630.1.101841 WP_000489630.1.101878 WP_000489630.1.101890 WP_000489630.1.10191 WP_000489630.1.101917 WP_000489630.1.101927 WP_000489630.1.101941 WP_000489630.1.101949 WP_000489630.1.101953 WP_000489630.1.101975 WP_000489630.1.102050 WP_000489630.1.102087 WP_000489630.1.102103 WP_000489630.1.102111 WP_000489630.1.10220 WP_000489630.1.10231 WP_000489630.1.10237 WP_000489630.1.10266 WP_000489630.1.10276 WP_000489630.1.10300 WP_000489630.1.10310 WP_000489630.1.10338 WP_000489630.1.1038 WP_000489630.1.10394 WP_000489630.1.104 WP_000489630.1.10401 WP_000489630.1.10428 WP_000489630.1.10429 WP_000489630.1.10439 WP_000489630.1.10459 WP_000489630.1.10465 WP_000489630.1.10475 WP_000489630.1.10498 WP_000489630.1.10511 WP_000489630.1.10514 WP_000489630.1.10521 WP_000489630.1.10530 WP_000489630.1.10532 WP_000489630.1.10547 WP_000489630.1.10562 WP_000489630.1.10566 WP_000489630.1.10568 WP_000489630.1.10595 WP_000489630.1.10631 WP_000489630.1.10642 WP_000489630.1.10654 WP_000489630.1.10675 WP_000489630.1.10677 WP_000489630.1.10678 WP_000489630.1.10711 WP_000489630.1.10720 WP_000489630.1.10753 WP_000489630.1.10755 WP_000489630.1.10857 WP_000489630.1.10868 WP_000489630.1.10873 WP_000489630.1.10898 WP_000489630.1.10926 WP_000489630.1.10936 WP_000489630.1.10992 WP_000489630.1.11000 WP_000489630.1.11012 WP_000489630.1.11024 WP_000489630.1.11031 WP_000489630.1.11055 WP_000489630.1.1110 WP_000489630.1.11119 WP_000489630.1.11126 WP_000489630.1.11142 WP_000489630.1.11156 WP_000489630.1.11168 WP_000489630.1.11190 WP_000489630.1.11216 WP_000489630.1.11239 WP_000489630.1.11253 WP_000489630.1.11254 WP_000489630.1.11295 WP_000489630.1.11304 WP_000489630.1.11314 WP_000489630.1.11362 WP_000489630.1.1137 WP_000489630.1.11385 WP_000489630.1.1142 WP_000489630.1.11426 WP_000489630.1.11429 WP_000489630.1.11455 WP_000489630.1.11458 WP_000489630.1.1150 WP_000489630.1.11518 WP_000489630.1.11526 WP_000489630.1.11528 WP_000489630.1.11532 WP_000489630.1.11543 WP_000489630.1.11557 WP_000489630.1.1156 WP_000489630.1.11565 WP_000489630.1.11567 WP_000489630.1.11588 WP_000489630.1.11638 WP_000489630.1.11677 WP_000489630.1.11687 WP_000489630.1.1169 WP_000489630.1.11735 WP_000489630.1.1174 WP_000489630.1.11763 WP_000489630.1.11772 WP_000489630.1.11824 WP_000489630.1.11834 WP_000489630.1.11841 WP_000489630.1.11865 WP_000489630.1.11868 WP_000489630.1.11875 WP_000489630.1.11883 WP_000489630.1.11897 WP_000489630.1.11900 WP_000489630.1.11908 WP_000489630.1.11914 WP_000489630.1.11936 WP_000489630.1.11938 WP_000489630.1.11964 WP_000489630.1.11978 WP_000489630.1.12017 WP_000489630.1.12025 WP_000489630.1.12027 WP_000489630.1.12040 WP_000489630.1.12061 WP_000489630.1.1207 WP_000489630.1.12106 WP_000489630.1.12114 WP_000489630.1.12141 WP_000489630.1.1215 WP_000489630.1.12159 WP_000489630.1.12168 WP_000489630.1.12172 WP_000489630.1.12192 WP_000489630.1.1224 WP_000489630.1.12244 WP_000489630.1.12280 WP_000489630.1.12340 WP_000489630.1.12351 WP_000489630.1.12364 WP_000489630.1.12370 WP_000489630.1.12374 WP_000489630.1.1239 WP_000489630.1.12397 WP_000489630.1.12398 WP_000489630.1.12441 WP_000489630.1.12456 WP_000489630.1.12472 WP_000489630.1.12484 WP_000489630.1.12485 WP_000489630.1.12546 WP_000489630.1.12568 WP_000489630.1.12569 WP_000489630.1.12581 WP_000489630.1.12584 WP_000489630.1.12585 WP_000489630.1.12620 WP_000489630.1.1264 WP_000489630.1.12648 WP_000489630.1.12683 WP_000489630.1.12696 WP_000489630.1.12701 WP_000489630.1.12726 WP_000489630.1.12727 WP_000489630.1.12728 WP_000489630.1.12741 WP_000489630.1.12834 WP_000489630.1.12864 WP_000489630.1.12879 WP_000489630.1.12936 WP_000489630.1.12995 WP_000489630.1.1300 WP_000489630.1.13027 WP_000489630.1.13076 WP_000489630.1.13102 WP_000489630.1.13106 WP_000489630.1.13108 WP_000489630.1.13130 WP_000489630.1.13161 WP_000489630.1.13207 WP_000489630.1.1321 WP_000489630.1.13247 WP_000489630.1.1326 WP_000489630.1.13268 WP_000489630.1.13274 WP_000489630.1.13291 WP_000489630.1.133 WP_000489630.1.13311 WP_000489630.1.13314 WP_000489630.1.13334 WP_000489630.1.13338 WP_000489630.1.13342 WP_000489630.1.13352 WP_000489630.1.13367 WP_000489630.1.13391 WP_000489630.1.13406 WP_000489630.1.13414 WP_000489630.1.13440 WP_000489630.1.13443 WP_000489630.1.13446 WP_000489630.1.1346 WP_000489630.1.13476 WP_000489630.1.13488 WP_000489630.1.13509 WP_000489630.1.13543 WP_000489630.1.13573 WP_000489630.1.13599 WP_000489630.1.13625 WP_000489630.1.13661 WP_000489630.1.13669 WP_000489630.1.13677 WP_000489630.1.13686 WP_000489630.1.1372 WP_000489630.1.13732 WP_000489630.1.13741 WP_000489630.1.13764 WP_000489630.1.1382 WP_000489630.1.13848 WP_000489630.1.13857 WP_000489630.1.1387 WP_000489630.1.13908 WP_000489630.1.13932 WP_000489630.1.13968 WP_000489630.1.13972 WP_000489630.1.140 WP_000489630.1.14001 WP_000489630.1.1401 WP_000489630.1.14041 WP_000489630.1.14050 WP_000489630.1.14056 WP_000489630.1.1408 WP_000489630.1.14089 WP_000489630.1.14099 WP_000489630.1.14111 WP_000489630.1.1412 WP_000489630.1.14120 WP_000489630.1.14123 WP_000489630.1.14150 WP_000489630.1.14151 WP_000489630.1.14197 WP_000489630.1.14239 WP_000489630.1.14280 WP_000489630.1.14286 WP_000489630.1.14320 WP_000489630.1.14333 WP_000489630.1.14369 WP_000489630.1.14379 WP_000489630.1.14399 WP_000489630.1.1440 WP_000489630.1.14406 WP_000489630.1.14410 WP_000489630.1.14436 WP_000489630.1.14444 WP_000489630.1.14458 WP_000489630.1.14466 WP_000489630.1.14467 WP_000489630.1.14474 WP_000489630.1.14495 WP_000489630.1.14500 WP_000489630.1.14505 WP_000489630.1.14516 WP_000489630.1.14519 WP_000489630.1.14524 WP_000489630.1.14526 WP_000489630.1.14550 WP_000489630.1.14554 WP_000489630.1.146 WP_000489630.1.14618 WP_000489630.1.14688 WP_000489630.1.14701 WP_000489630.1.14703 WP_000489630.1.14708 WP_000489630.1.14719 WP_000489630.1.14725 WP_000489630.1.1473 WP_000489630.1.14737 WP_000489630.1.14765 WP_000489630.1.14789 WP_000489630.1.14793 WP_000489630.1.14808 WP_000489630.1.14810 WP_000489630.1.14819 WP_000489630.1.14852 WP_000489630.1.14876 WP_000489630.1.14877 WP_000489630.1.14884 WP_000489630.1.1489 WP_000489630.1.14894 WP_000489630.1.14913 WP_000489630.1.14930 WP_000489630.1.14932 WP_000489630.1.14936 WP_000489630.1.14947 WP_000489630.1.14948 WP_000489630.1.14964 WP_000489630.1.15055 WP_000489630.1.15067 WP_000489630.1.15079 WP_000489630.1.15100 WP_000489630.1.15102 WP_000489630.1.15124 WP_000489630.1.15184 WP_000489630.1.15214 WP_000489630.1.15223 WP_000489630.1.15226 WP_000489630.1.15244 WP_000489630.1.15265 WP_000489630.1.15276 WP_000489630.1.15316 WP_000489630.1.15318 WP_000489630.1.15362 WP_000489630.1.15369 WP_000489630.1.1540 WP_000489630.1.15415 WP_000489630.1.15423 WP_000489630.1.15433 WP_000489630.1.15439 WP_000489630.1.15483 WP_000489630.1.15487 WP_000489630.1.15508 WP_000489630.1.1551 WP_000489630.1.15535 WP_000489630.1.15581 WP_000489630.1.15585 WP_000489630.1.15586 WP_000489630.1.15597 WP_000489630.1.15612 WP_000489630.1.15625 WP_000489630.1.15627 WP_000489630.1.1568 WP_000489630.1.15708 WP_000489630.1.15710 WP_000489630.1.15717 WP_000489630.1.15775 WP_000489630.1.15777 WP_000489630.1.15784 WP_000489630.1.158 WP_000489630.1.15830 WP_000489630.1.15835 WP_000489630.1.15862 WP_000489630.1.15905 WP_000489630.1.15909 WP_000489630.1.15910 WP_000489630.1.15912 WP_000489630.1.1592 WP_000489630.1.15922 WP_000489630.1.15970 WP_000489630.1.15986 WP_000489630.1.15995 WP_000489630.1.16000 WP_000489630.1.16004 WP_000489630.1.16006 WP_000489630.1.1601 WP_000489630.1.16028 WP_000489630.1.16032 WP_000489630.1.16046 WP_000489630.1.16047 WP_000489630.1.16051 WP_000489630.1.16058 WP_000489630.1.16062 WP_000489630.1.16063 WP_000489630.1.16103 WP_000489630.1.16125 WP_000489630.1.16150 WP_000489630.1.16155 WP_000489630.1.16172 WP_000489630.1.16233 WP_000489630.1.1626 WP_000489630.1.16264 WP_000489630.1.16284 WP_000489630.1.16328 WP_000489630.1.16331 WP_000489630.1.16344 WP_000489630.1.1635 WP_000489630.1.16361 WP_000489630.1.16363 WP_000489630.1.16365 WP_000489630.1.16366 WP_000489630.1.16394 WP_000489630.1.16452 WP_000489630.1.16453 WP_000489630.1.16461 WP_000489630.1.16465 WP_000489630.1.16468 WP_000489630.1.16474 WP_000489630.1.16525 WP_000489630.1.16551 WP_000489630.1.16581 WP_000489630.1.16588 WP_000489630.1.16614 WP_000489630.1.16650 WP_000489630.1.16658 WP_000489630.1.16666 WP_000489630.1.16673 WP_000489630.1.1668 WP_000489630.1.16686 WP_000489630.1.16691 WP_000489630.1.167 WP_000489630.1.16729 WP_000489630.1.16732 WP_000489630.1.16735 WP_000489630.1.16736 WP_000489630.1.1674 WP_000489630.1.16767 WP_000489630.1.16781 WP_000489630.1.16786 WP_000489630.1.16819 WP_000489630.1.16846 WP_000489630.1.16858 WP_000489630.1.16873 WP_000489630.1.16879 WP_000489630.1.1689 WP_000489630.1.16893 WP_000489630.1.16896 WP_000489630.1.16903 WP_000489630.1.16905 WP_000489630.1.16941 WP_000489630.1.16944 WP_000489630.1.16948 WP_000489630.1.16949 WP_000489630.1.16965 WP_000489630.1.16972 WP_000489630.1.16998 WP_000489630.1.1700 WP_000489630.1.17031 WP_000489630.1.17049 WP_000489630.1.17058 WP_000489630.1.17060 WP_000489630.1.17078 WP_000489630.1.17093 WP_000489630.1.17096 WP_000489630.1.17105 WP_000489630.1.17188 WP_000489630.1.17202 WP_000489630.1.17219 WP_000489630.1.1722 WP_000489630.1.17285 WP_000489630.1.17302 WP_000489630.1.17307 WP_000489630.1.17308 WP_000489630.1.1733 WP_000489630.1.17368 WP_000489630.1.1737 WP_000489630.1.17390 WP_000489630.1.174 WP_000489630.1.17405 WP_000489630.1.17406 WP_000489630.1.17439 WP_000489630.1.17447 WP_000489630.1.17480 WP_000489630.1.17482 WP_000489630.1.1749 WP_000489630.1.17504 WP_000489630.1.17513 WP_000489630.1.17525 WP_000489630.1.17543 WP_000489630.1.17546 WP_000489630.1.17560 WP_000489630.1.17563 WP_000489630.1.1757 WP_000489630.1.17578 WP_000489630.1.17583 WP_000489630.1.17622 WP_000489630.1.17629 WP_000489630.1.17659 WP_000489630.1.17667 WP_000489630.1.17686 WP_000489630.1.17693 WP_000489630.1.17702 WP_000489630.1.17705 WP_000489630.1.17732 WP_000489630.1.17741 WP_000489630.1.17743 WP_000489630.1.17747 WP_000489630.1.17755 WP_000489630.1.17840 WP_000489630.1.17865 WP_000489630.1.17886 WP_000489630.1.17901 WP_000489630.1.17914 WP_000489630.1.17919 WP_000489630.1.17936 WP_000489630.1.17956 WP_000489630.1.1798 WP_000489630.1.17991 WP_000489630.1.18005 WP_000489630.1.1801 WP_000489630.1.18019 WP_000489630.1.18021 WP_000489630.1.18056 WP_000489630.1.18061 WP_000489630.1.18092 WP_000489630.1.18099 WP_000489630.1.18109 WP_000489630.1.18111 WP_000489630.1.18122 WP_000489630.1.18124 WP_000489630.1.1814 WP_000489630.1.18144 WP_000489630.1.18149 WP_000489630.1.18163 WP_000489630.1.18173 WP_000489630.1.18178 WP_000489630.1.1818 WP_000489630.1.18192 WP_000489630.1.18249 WP_000489630.1.1825 WP_000489630.1.18254 WP_000489630.1.18265 WP_000489630.1.18267 WP_000489630.1.18270 WP_000489630.1.18280 WP_000489630.1.18281 WP_000489630.1.18282 WP_000489630.1.18328 WP_000489630.1.18358 WP_000489630.1.18370 WP_000489630.1.18406 WP_000489630.1.18426 WP_000489630.1.18441 WP_000489630.1.18468 WP_000489630.1.18474 WP_000489630.1.18513 WP_000489630.1.18607 WP_000489630.1.18610 WP_000489630.1.18641 WP_000489630.1.18678 WP_000489630.1.18686 WP_000489630.1.18692 WP_000489630.1.18705 WP_000489630.1.18715 WP_000489630.1.18722 WP_000489630.1.18737 WP_000489630.1.18766 WP_000489630.1.18776 WP_000489630.1.1880 WP_000489630.1.18822 WP_000489630.1.18847 WP_000489630.1.1885 WP_000489630.1.18860 WP_000489630.1.18881 WP_000489630.1.18886 WP_000489630.1.18922 WP_000489630.1.18940 WP_000489630.1.18949 WP_000489630.1.1895 WP_000489630.1.18959 WP_000489630.1.1897 WP_000489630.1.18972 WP_000489630.1.19001 WP_000489630.1.19006 WP_000489630.1.19030 WP_000489630.1.19044 WP_000489630.1.19053 WP_000489630.1.19084 WP_000489630.1.19093 WP_000489630.1.19163 WP_000489630.1.19187 WP_000489630.1.19228 WP_000489630.1.19273 WP_000489630.1.19288 WP_000489630.1.19291 WP_000489630.1.19300 WP_000489630.1.19320 WP_000489630.1.19373 WP_000489630.1.19422 WP_000489630.1.19433 WP_000489630.1.19454 WP_000489630.1.19456 WP_000489630.1.19458 WP_000489630.1.19460 WP_000489630.1.19461 WP_000489630.1.19496 WP_000489630.1.19535 WP_000489630.1.19538 WP_000489630.1.1955 WP_000489630.1.19588 WP_000489630.1.19589 WP_000489630.1.19614 WP_000489630.1.19616 WP_000489630.1.19642 WP_000489630.1.19656 WP_000489630.1.19660 WP_000489630.1.19663 WP_000489630.1.1968 WP_000489630.1.19686 WP_000489630.1.19702 WP_000489630.1.19706 WP_000489630.1.19723 WP_000489630.1.19724 WP_000489630.1.19731 WP_000489630.1.19740 WP_000489630.1.19749 WP_000489630.1.19784 WP_000489630.1.19793 WP_000489630.1.19794 WP_000489630.1.19802 WP_000489630.1.19809 WP_000489630.1.19834 WP_000489630.1.19867 WP_000489630.1.1990 WP_000489630.1.1992 WP_000489630.1.19938 WP_000489630.1.19975 WP_000489630.1.1998 WP_000489630.1.19999 WP_000489630.1.20 WP_000489630.1.20034 WP_000489630.1.20086 WP_000489630.1.20089 WP_000489630.1.2010 WP_000489630.1.20119 WP_000489630.1.20212 WP_000489630.1.20218 WP_000489630.1.20254 WP_000489630.1.20255 WP_000489630.1.20261 WP_000489630.1.20266 WP_000489630.1.20271 WP_000489630.1.20296 WP_000489630.1.20330 WP_000489630.1.20339 WP_000489630.1.20362 WP_000489630.1.20376 WP_000489630.1.20391 WP_000489630.1.2041 WP_000489630.1.20415 WP_000489630.1.20418 WP_000489630.1.20419 WP_000489630.1.20425 WP_000489630.1.20437 WP_000489630.1.20443 WP_000489630.1.20446 WP_000489630.1.20465 WP_000489630.1.2047 WP_000489630.1.20488 WP_000489630.1.20492 WP_000489630.1.20503 WP_000489630.1.20525 WP_000489630.1.2053 WP_000489630.1.2054 WP_000489630.1.20553 WP_000489630.1.20614 WP_000489630.1.20626 WP_000489630.1.20631 WP_000489630.1.20635 WP_000489630.1.20646 WP_000489630.1.20695 WP_000489630.1.20700 WP_000489630.1.20718 WP_000489630.1.20721 WP_000489630.1.2073 WP_000489630.1.20740 WP_000489630.1.20767 WP_000489630.1.20789 WP_000489630.1.20828 WP_000489630.1.20862 WP_000489630.1.2087 WP_000489630.1.20883 WP_000489630.1.20886 WP_000489630.1.20900 WP_000489630.1.20908 WP_000489630.1.2091 WP_000489630.1.20947 WP_000489630.1.20953 WP_000489630.1.21010 WP_000489630.1.21049 WP_000489630.1.2106 WP_000489630.1.21062 WP_000489630.1.2107 WP_000489630.1.21075 WP_000489630.1.21079 WP_000489630.1.21089 WP_000489630.1.21103 WP_000489630.1.21136 WP_000489630.1.21144 WP_000489630.1.21146 WP_000489630.1.2116 WP_000489630.1.21162 WP_000489630.1.21184 WP_000489630.1.21185 WP_000489630.1.21194 WP_000489630.1.21202 WP_000489630.1.21241 WP_000489630.1.21245 WP_000489630.1.21246 WP_000489630.1.21269 WP_000489630.1.21309 WP_000489630.1.21326 WP_000489630.1.21332 WP_000489630.1.21351 WP_000489630.1.21366 WP_000489630.1.21400 WP_000489630.1.21404 WP_000489630.1.21443 WP_000489630.1.21453 WP_000489630.1.2146 WP_000489630.1.21492 WP_000489630.1.21497 WP_000489630.1.21499 WP_000489630.1.21548 WP_000489630.1.21603 WP_000489630.1.21616 WP_000489630.1.21674 WP_000489630.1.21681 WP_000489630.1.21692 WP_000489630.1.21715 WP_000489630.1.21751 WP_000489630.1.21757 WP_000489630.1.21792 WP_000489630.1.21825 WP_000489630.1.21845 WP_000489630.1.21909 WP_000489630.1.21910 WP_000489630.1.21940 WP_000489630.1.21946 WP_000489630.1.21950 WP_000489630.1.21981 WP_000489630.1.21991 WP_000489630.1.22019 WP_000489630.1.22024 WP_000489630.1.22030 WP_000489630.1.2205 WP_000489630.1.22051 WP_000489630.1.22062 WP_000489630.1.22064 WP_000489630.1.22067 WP_000489630.1.22096 WP_000489630.1.22117 WP_000489630.1.22118 WP_000489630.1.22126 WP_000489630.1.22136 WP_000489630.1.22158 WP_000489630.1.2216 WP_000489630.1.22162 WP_000489630.1.22169 WP_000489630.1.22205 WP_000489630.1.22208 WP_000489630.1.22235 WP_000489630.1.2224 WP_000489630.1.2227 WP_000489630.1.22296 WP_000489630.1.22337 WP_000489630.1.22346 WP_000489630.1.2235 WP_000489630.1.22373 WP_000489630.1.22379 WP_000489630.1.22427 WP_000489630.1.22449 WP_000489630.1.22454 WP_000489630.1.2246 WP_000489630.1.22460 WP_000489630.1.22476 WP_000489630.1.22485 WP_000489630.1.22514 WP_000489630.1.22537 WP_000489630.1.22575 WP_000489630.1.22582 WP_000489630.1.22590 WP_000489630.1.22595 WP_000489630.1.22605 WP_000489630.1.22614 WP_000489630.1.22620 WP_000489630.1.22652 WP_000489630.1.22676 WP_000489630.1.22683 WP_000489630.1.22692 WP_000489630.1.22760 WP_000489630.1.2284 WP_000489630.1.22845 WP_000489630.1.22857 WP_000489630.1.22864 WP_000489630.1.22870 WP_000489630.1.22880 WP_000489630.1.22895 WP_000489630.1.22902 WP_000489630.1.22926 WP_000489630.1.22943 WP_000489630.1.22947 WP_000489630.1.22967 WP_000489630.1.22979 WP_000489630.1.23040 WP_000489630.1.23058 WP_000489630.1.23102 WP_000489630.1.23114 WP_000489630.1.2314 WP_000489630.1.23155 WP_000489630.1.23169 WP_000489630.1.23172 WP_000489630.1.23192 WP_000489630.1.23218 WP_000489630.1.2324 WP_000489630.1.23246 WP_000489630.1.23259 WP_000489630.1.23279 WP_000489630.1.23309 WP_000489630.1.2331 WP_000489630.1.23311 WP_000489630.1.2332 WP_000489630.1.23329 WP_000489630.1.23340 WP_000489630.1.23343 WP_000489630.1.2336 WP_000489630.1.23365 WP_000489630.1.23379 WP_000489630.1.23412 WP_000489630.1.2342 WP_000489630.1.23426 WP_000489630.1.23442 WP_000489630.1.23460 WP_000489630.1.23466 WP_000489630.1.23472 WP_000489630.1.23482 WP_000489630.1.23492 WP_000489630.1.23500 WP_000489630.1.23503 WP_000489630.1.23509 WP_000489630.1.23513 WP_000489630.1.23548 WP_000489630.1.23571 WP_000489630.1.2358 WP_000489630.1.23604 WP_000489630.1.23621 WP_000489630.1.23631 WP_000489630.1.23634 WP_000489630.1.23639 WP_000489630.1.2364 WP_000489630.1.23643 WP_000489630.1.23646 WP_000489630.1.23670 WP_000489630.1.23679 WP_000489630.1.23685 WP_000489630.1.237 WP_000489630.1.23707 WP_000489630.1.23720 WP_000489630.1.23728 WP_000489630.1.23736 WP_000489630.1.23746 WP_000489630.1.2375 WP_000489630.1.2376 WP_000489630.1.23783 WP_000489630.1.23786 WP_000489630.1.23787 WP_000489630.1.23801 WP_000489630.1.23819 WP_000489630.1.23932 WP_000489630.1.23959 WP_000489630.1.24017 WP_000489630.1.24028 WP_000489630.1.24061 WP_000489630.1.24082 WP_000489630.1.24083 WP_000489630.1.24117 WP_000489630.1.24125 WP_000489630.1.24138 WP_000489630.1.24145 WP_000489630.1.2415 WP_000489630.1.24153 WP_000489630.1.24163 WP_000489630.1.24206 WP_000489630.1.24214 WP_000489630.1.24250 WP_000489630.1.24291 WP_000489630.1.24297 WP_000489630.1.24308 WP_000489630.1.24322 WP_000489630.1.24325 WP_000489630.1.24355 WP_000489630.1.24361 WP_000489630.1.24375 WP_000489630.1.24376 WP_000489630.1.24392 WP_000489630.1.24400 WP_000489630.1.24408 WP_000489630.1.24409 WP_000489630.1.24419 WP_000489630.1.24420 WP_000489630.1.24433 WP_000489630.1.24444 WP_000489630.1.24476 WP_000489630.1.24494 WP_000489630.1.24555 WP_000489630.1.24567 WP_000489630.1.24578 WP_000489630.1.24619 WP_000489630.1.24643 WP_000489630.1.2467 WP_000489630.1.24673 WP_000489630.1.24686 WP_000489630.1.24688 WP_000489630.1.24716 WP_000489630.1.24737 WP_000489630.1.24779 WP_000489630.1.24803 WP_000489630.1.2481 WP_000489630.1.24832 WP_000489630.1.24839 WP_000489630.1.24901 WP_000489630.1.24944 WP_000489630.1.24964 WP_000489630.1.24995 WP_000489630.1.25008 WP_000489630.1.25015 WP_000489630.1.25017 WP_000489630.1.25032 WP_000489630.1.25036 WP_000489630.1.25041 WP_000489630.1.25053 WP_000489630.1.25072 WP_000489630.1.25119 WP_000489630.1.25140 WP_000489630.1.25159 WP_000489630.1.25175 WP_000489630.1.25185 WP_000489630.1.25196 WP_000489630.1.25206 WP_000489630.1.25210 WP_000489630.1.25219 WP_000489630.1.25304 WP_000489630.1.25354 WP_000489630.1.25374 WP_000489630.1.25405 WP_000489630.1.25421 WP_000489630.1.25426 WP_000489630.1.25454 WP_000489630.1.25475 WP_000489630.1.25490 WP_000489630.1.25493 WP_000489630.1.25498 WP_000489630.1.25508 WP_000489630.1.25512 WP_000489630.1.2554 WP_000489630.1.25546 WP_000489630.1.25564 WP_000489630.1.25603 WP_000489630.1.25618 WP_000489630.1.2562 WP_000489630.1.25666 WP_000489630.1.25668 WP_000489630.1.2568 WP_000489630.1.25690 WP_000489630.1.2570 WP_000489630.1.25700 WP_000489630.1.25709 WP_000489630.1.25722 WP_000489630.1.25740 WP_000489630.1.25780 WP_000489630.1.25793 WP_000489630.1.25807 WP_000489630.1.25809 WP_000489630.1.25814 WP_000489630.1.25821 WP_000489630.1.25833 WP_000489630.1.25835 WP_000489630.1.25882 WP_000489630.1.25911 WP_000489630.1.25928 WP_000489630.1.25932 WP_000489630.1.25951 WP_000489630.1.25962 WP_000489630.1.25963 WP_000489630.1.25988 WP_000489630.1.26001 WP_000489630.1.26027 WP_000489630.1.26030 WP_000489630.1.26083 WP_000489630.1.26107 WP_000489630.1.26123 WP_000489630.1.2615 WP_000489630.1.26194 WP_000489630.1.26217 WP_000489630.1.26230 WP_000489630.1.26232 WP_000489630.1.26269 WP_000489630.1.26272 WP_000489630.1.26282 WP_000489630.1.26286 WP_000489630.1.26288 WP_000489630.1.26311 WP_000489630.1.26319 WP_000489630.1.2634 WP_000489630.1.26363 WP_000489630.1.26394 WP_000489630.1.26426 WP_000489630.1.26429 WP_000489630.1.26440 WP_000489630.1.26441 WP_000489630.1.26491 WP_000489630.1.26493 WP_000489630.1.26532 WP_000489630.1.2654 WP_000489630.1.26551 WP_000489630.1.26554 WP_000489630.1.26567 WP_000489630.1.26582 WP_000489630.1.26587 WP_000489630.1.2660 WP_000489630.1.26636 WP_000489630.1.26687 WP_000489630.1.26689 WP_000489630.1.2672 WP_000489630.1.26741 WP_000489630.1.2679 WP_000489630.1.26794 WP_000489630.1.26856 WP_000489630.1.26882 WP_000489630.1.26892 WP_000489630.1.26908 WP_000489630.1.26919 WP_000489630.1.2692 WP_000489630.1.26924 WP_000489630.1.26928 WP_000489630.1.26936 WP_000489630.1.26980 WP_000489630.1.270 WP_000489630.1.27008 WP_000489630.1.27010 WP_000489630.1.27027 WP_000489630.1.27051 WP_000489630.1.27070 WP_000489630.1.27072 WP_000489630.1.27077 WP_000489630.1.27084 WP_000489630.1.27086 WP_000489630.1.27087 WP_000489630.1.27111 WP_000489630.1.27115 WP_000489630.1.2717 WP_000489630.1.27173 WP_000489630.1.27206 WP_000489630.1.27223 WP_000489630.1.27228 WP_000489630.1.27255 WP_000489630.1.27272 WP_000489630.1.27279 WP_000489630.1.27282 WP_000489630.1.27285 WP_000489630.1.27309 WP_000489630.1.27314 WP_000489630.1.27329 WP_000489630.1.27342 WP_000489630.1.27361 WP_000489630.1.27383 WP_000489630.1.27419 WP_000489630.1.27423 WP_000489630.1.27513 WP_000489630.1.27522 WP_000489630.1.27523 WP_000489630.1.27535 WP_000489630.1.27544 WP_000489630.1.27547 WP_000489630.1.27556 WP_000489630.1.27561 WP_000489630.1.27565 WP_000489630.1.27595 WP_000489630.1.27598 WP_000489630.1.27616 WP_000489630.1.2763 WP_000489630.1.27632 WP_000489630.1.27638 WP_000489630.1.27658 WP_000489630.1.27665 WP_000489630.1.27679 WP_000489630.1.27706 WP_000489630.1.27707 WP_000489630.1.27755 WP_000489630.1.27761 WP_000489630.1.2777 WP_000489630.1.27775 WP_000489630.1.27776 WP_000489630.1.27785 WP_000489630.1.27798 WP_000489630.1.27800 WP_000489630.1.27815 WP_000489630.1.27833 WP_000489630.1.27857 WP_000489630.1.27883 WP_000489630.1.27900 WP_000489630.1.27928 WP_000489630.1.27945 WP_000489630.1.27977 WP_000489630.1.27995 WP_000489630.1.27997 WP_000489630.1.28004 WP_000489630.1.28032 WP_000489630.1.28056 WP_000489630.1.28073 WP_000489630.1.2809 WP_000489630.1.28094 WP_000489630.1.28126 WP_000489630.1.28139 WP_000489630.1.28155 WP_000489630.1.28170 WP_000489630.1.28198 WP_000489630.1.28200 WP_000489630.1.2822 WP_000489630.1.28225 WP_000489630.1.28229 WP_000489630.1.28232 WP_000489630.1.28233 WP_000489630.1.28235 WP_000489630.1.2825 WP_000489630.1.28301 WP_000489630.1.28302 WP_000489630.1.28303 WP_000489630.1.2835 WP_000489630.1.28370 WP_000489630.1.28384 WP_000489630.1.28386 WP_000489630.1.28393 WP_000489630.1.28395 WP_000489630.1.284 WP_000489630.1.2845 WP_000489630.1.28462 WP_000489630.1.28479 WP_000489630.1.28504 WP_000489630.1.2853 WP_000489630.1.28538 WP_000489630.1.28570 WP_000489630.1.28575 WP_000489630.1.28612 WP_000489630.1.28620 WP_000489630.1.28625 WP_000489630.1.28627 WP_000489630.1.28655 WP_000489630.1.28673 WP_000489630.1.28692 WP_000489630.1.28694 WP_000489630.1.287 WP_000489630.1.2873 WP_000489630.1.28733 WP_000489630.1.28775 WP_000489630.1.28776 WP_000489630.1.2879 WP_000489630.1.2890 WP_000489630.1.28917 WP_000489630.1.28938 WP_000489630.1.28946 WP_000489630.1.28948 WP_000489630.1.28962 WP_000489630.1.29006 WP_000489630.1.29010 WP_000489630.1.29023 WP_000489630.1.29042 WP_000489630.1.2905 WP_000489630.1.2907 WP_000489630.1.29089 WP_000489630.1.2910 WP_000489630.1.29113 WP_000489630.1.29130 WP_000489630.1.29153 WP_000489630.1.29168 WP_000489630.1.29174 WP_000489630.1.29203 WP_000489630.1.29218 WP_000489630.1.29237 WP_000489630.1.2924 WP_000489630.1.29248 WP_000489630.1.29274 WP_000489630.1.29288 WP_000489630.1.2932 WP_000489630.1.29349 WP_000489630.1.29379 WP_000489630.1.29389 WP_000489630.1.29422 WP_000489630.1.29436 WP_000489630.1.29439 WP_000489630.1.29454 WP_000489630.1.2946 WP_000489630.1.29462 WP_000489630.1.29509 WP_000489630.1.29530 WP_000489630.1.29576 WP_000489630.1.29588 WP_000489630.1.29601 WP_000489630.1.29606 WP_000489630.1.29615 WP_000489630.1.29619 WP_000489630.1.29682 WP_000489630.1.29704 WP_000489630.1.29711 WP_000489630.1.29727 WP_000489630.1.29743 WP_000489630.1.29768 WP_000489630.1.29774 WP_000489630.1.29775 WP_000489630.1.29782 WP_000489630.1.29827 WP_000489630.1.29833 WP_000489630.1.2984 WP_000489630.1.29845 WP_000489630.1.29851 WP_000489630.1.29865 WP_000489630.1.29886 WP_000489630.1.29898 WP_000489630.1.29919 WP_000489630.1.29923 WP_000489630.1.2994 WP_000489630.1.29964 WP_000489630.1.29969 WP_000489630.1.29983 WP_000489630.1.29990 WP_000489630.1.30006 WP_000489630.1.30009 WP_000489630.1.30013 WP_000489630.1.3002 WP_000489630.1.30022 WP_000489630.1.30027 WP_000489630.1.30034 WP_000489630.1.30049 WP_000489630.1.3005 WP_000489630.1.30058 WP_000489630.1.30093 WP_000489630.1.30165 WP_000489630.1.3017 WP_000489630.1.30170 WP_000489630.1.30172 WP_000489630.1.30179 WP_000489630.1.30180 WP_000489630.1.30185 WP_000489630.1.30195 WP_000489630.1.30202 WP_000489630.1.30210 WP_000489630.1.30238 WP_000489630.1.30246 WP_000489630.1.30278 WP_000489630.1.30354 WP_000489630.1.30356 WP_000489630.1.30357 WP_000489630.1.30362 WP_000489630.1.3042 WP_000489630.1.30421 WP_000489630.1.30425 WP_000489630.1.30437 WP_000489630.1.30440 WP_000489630.1.30448 WP_000489630.1.30469 WP_000489630.1.30489 WP_000489630.1.30492 WP_000489630.1.30505 WP_000489630.1.30507 WP_000489630.1.30517 WP_000489630.1.30535 WP_000489630.1.30542 WP_000489630.1.30544 WP_000489630.1.30547 WP_000489630.1.30548 WP_000489630.1.30556 WP_000489630.1.30572 WP_000489630.1.30573 WP_000489630.1.30585 WP_000489630.1.30589 WP_000489630.1.30602 WP_000489630.1.30618 WP_000489630.1.30619 WP_000489630.1.30627 WP_000489630.1.30664 WP_000489630.1.3067 WP_000489630.1.3068 WP_000489630.1.30688 WP_000489630.1.30752 WP_000489630.1.3076 WP_000489630.1.30794 WP_000489630.1.3080 WP_000489630.1.30806 WP_000489630.1.30819 WP_000489630.1.30823 WP_000489630.1.30833 WP_000489630.1.30835 WP_000489630.1.30909 WP_000489630.1.30967 WP_000489630.1.30968 WP_000489630.1.30972 WP_000489630.1.31 WP_000489630.1.31001 WP_000489630.1.31011 WP_000489630.1.31046 WP_000489630.1.31066 WP_000489630.1.31078 WP_000489630.1.31092 WP_000489630.1.31107 WP_000489630.1.31122 WP_000489630.1.3113 WP_000489630.1.31139 WP_000489630.1.3114 WP_000489630.1.31145 WP_000489630.1.31156 WP_000489630.1.31167 WP_000489630.1.31171 WP_000489630.1.31182 WP_000489630.1.31185 WP_000489630.1.3119 WP_000489630.1.31190 WP_000489630.1.31195 WP_000489630.1.31196 WP_000489630.1.31198 WP_000489630.1.31205 WP_000489630.1.3121 WP_000489630.1.31210 WP_000489630.1.31219 WP_000489630.1.31222 WP_000489630.1.31223 WP_000489630.1.3124 WP_000489630.1.31251 WP_000489630.1.31272 WP_000489630.1.31281 WP_000489630.1.31303 WP_000489630.1.3131 WP_000489630.1.31335 WP_000489630.1.31352 WP_000489630.1.31389 WP_000489630.1.31413 WP_000489630.1.31435 WP_000489630.1.31446 WP_000489630.1.31451 WP_000489630.1.31476 WP_000489630.1.31504 WP_000489630.1.31515 WP_000489630.1.31533 WP_000489630.1.31578 WP_000489630.1.31585 WP_000489630.1.31658 WP_000489630.1.3167 WP_000489630.1.31720 WP_000489630.1.31725 WP_000489630.1.31762 WP_000489630.1.31799 WP_000489630.1.31836 WP_000489630.1.31845 WP_000489630.1.31895 WP_000489630.1.31901 WP_000489630.1.31927 WP_000489630.1.31940 WP_000489630.1.31951 WP_000489630.1.31967 WP_000489630.1.31972 WP_000489630.1.31983 WP_000489630.1.32006 WP_000489630.1.32041 WP_000489630.1.32042 WP_000489630.1.32056 WP_000489630.1.3207 WP_000489630.1.32109 WP_000489630.1.32116 WP_000489630.1.32170 WP_000489630.1.32189 WP_000489630.1.32192 WP_000489630.1.32202 WP_000489630.1.32206 WP_000489630.1.32252 WP_000489630.1.32255 WP_000489630.1.32260 WP_000489630.1.32263 WP_000489630.1.32274 WP_000489630.1.32277 WP_000489630.1.32293 WP_000489630.1.32299 WP_000489630.1.32309 WP_000489630.1.32368 WP_000489630.1.32422 WP_000489630.1.32423 WP_000489630.1.32425 WP_000489630.1.32434 WP_000489630.1.32438 WP_000489630.1.32458 WP_000489630.1.32460 WP_000489630.1.32491 WP_000489630.1.32515 WP_000489630.1.32519 WP_000489630.1.32527 WP_000489630.1.32529 WP_000489630.1.32545 WP_000489630.1.32563 WP_000489630.1.32578 WP_000489630.1.32617 WP_000489630.1.32624 WP_000489630.1.32629 WP_000489630.1.32660 WP_000489630.1.32668 WP_000489630.1.3270 WP_000489630.1.32702 WP_000489630.1.32714 WP_000489630.1.32725 WP_000489630.1.32740 WP_000489630.1.32747 WP_000489630.1.32786 WP_000489630.1.32804 WP_000489630.1.32832 WP_000489630.1.32838 WP_000489630.1.32848 WP_000489630.1.32860 WP_000489630.1.32868 WP_000489630.1.32881 WP_000489630.1.32899 WP_000489630.1.3290 WP_000489630.1.32902 WP_000489630.1.32907 WP_000489630.1.32940 WP_000489630.1.32941 WP_000489630.1.3296 WP_000489630.1.32966 WP_000489630.1.32977 WP_000489630.1.32985 WP_000489630.1.33010 WP_000489630.1.33030 WP_000489630.1.3305 WP_000489630.1.33051 WP_000489630.1.33065 WP_000489630.1.33078 WP_000489630.1.33106 WP_000489630.1.33122 WP_000489630.1.33127 WP_000489630.1.33143 WP_000489630.1.3315 WP_000489630.1.33160 WP_000489630.1.33208 WP_000489630.1.33214 WP_000489630.1.33247 WP_000489630.1.33248 WP_000489630.1.33253 WP_000489630.1.33261 WP_000489630.1.33270 WP_000489630.1.33280 WP_000489630.1.33283 WP_000489630.1.333 WP_000489630.1.33313 WP_000489630.1.33339 WP_000489630.1.33382 WP_000489630.1.33409 WP_000489630.1.33486 WP_000489630.1.33490 WP_000489630.1.33492 WP_000489630.1.33499 WP_000489630.1.335 WP_000489630.1.33501 WP_000489630.1.33529 WP_000489630.1.33553 WP_000489630.1.3356 WP_000489630.1.33580 WP_000489630.1.33586 WP_000489630.1.33592 WP_000489630.1.33609 WP_000489630.1.33629 WP_000489630.1.33689 WP_000489630.1.3370 WP_000489630.1.33730 WP_000489630.1.33741 WP_000489630.1.33817 WP_000489630.1.33825 WP_000489630.1.33840 WP_000489630.1.33865 WP_000489630.1.33894 WP_000489630.1.3392 WP_000489630.1.33926 WP_000489630.1.3394 WP_000489630.1.3395 WP_000489630.1.33957 WP_000489630.1.3396 WP_000489630.1.33969 WP_000489630.1.33986 WP_000489630.1.34 WP_000489630.1.34001 WP_000489630.1.34043 WP_000489630.1.34059 WP_000489630.1.34075 WP_000489630.1.34081 WP_000489630.1.34091 WP_000489630.1.34107 WP_000489630.1.34118 WP_000489630.1.34126 WP_000489630.1.34185 WP_000489630.1.34211 WP_000489630.1.34214 WP_000489630.1.34234 WP_000489630.1.34257 WP_000489630.1.34259 WP_000489630.1.34279 WP_000489630.1.34284 WP_000489630.1.34292 WP_000489630.1.34304 WP_000489630.1.34319 WP_000489630.1.34376 WP_000489630.1.3438 WP_000489630.1.34382 WP_000489630.1.34417 WP_000489630.1.34431 WP_000489630.1.34453 WP_000489630.1.34454 WP_000489630.1.34458 WP_000489630.1.34484 WP_000489630.1.34496 WP_000489630.1.34517 WP_000489630.1.34530 WP_000489630.1.34610 WP_000489630.1.34665 WP_000489630.1.34667 WP_000489630.1.34684 WP_000489630.1.34694 WP_000489630.1.34703 WP_000489630.1.34704 WP_000489630.1.34707 WP_000489630.1.34711 WP_000489630.1.34751 WP_000489630.1.3476 WP_000489630.1.34801 WP_000489630.1.34808 WP_000489630.1.34817 WP_000489630.1.34820 WP_000489630.1.34824 WP_000489630.1.34834 WP_000489630.1.34854 WP_000489630.1.34856 WP_000489630.1.3489 WP_000489630.1.34932 WP_000489630.1.34962 WP_000489630.1.34972 WP_000489630.1.34975 WP_000489630.1.34977 WP_000489630.1.35001 WP_000489630.1.35040 WP_000489630.1.35045 WP_000489630.1.35074 WP_000489630.1.35129 WP_000489630.1.35175 WP_000489630.1.35184 WP_000489630.1.35193 WP_000489630.1.35219 WP_000489630.1.35240 WP_000489630.1.35274 WP_000489630.1.35298 WP_000489630.1.35321 WP_000489630.1.35332 WP_000489630.1.35404 WP_000489630.1.35408 WP_000489630.1.35425 WP_000489630.1.35429 WP_000489630.1.35460 WP_000489630.1.35463 WP_000489630.1.35494 WP_000489630.1.35503 WP_000489630.1.35509 WP_000489630.1.35532 WP_000489630.1.3556 WP_000489630.1.35560 WP_000489630.1.35563 WP_000489630.1.3557 WP_000489630.1.35570 WP_000489630.1.35590 WP_000489630.1.35594 WP_000489630.1.35619 WP_000489630.1.35624 WP_000489630.1.35628 WP_000489630.1.35648 WP_000489630.1.3566 WP_000489630.1.3570 WP_000489630.1.35712 WP_000489630.1.35713 WP_000489630.1.3572 WP_000489630.1.35736 WP_000489630.1.35791 WP_000489630.1.35795 WP_000489630.1.35870 WP_000489630.1.35887 WP_000489630.1.35892 WP_000489630.1.35916 WP_000489630.1.35936 WP_000489630.1.35938 WP_000489630.1.35940 WP_000489630.1.35961 WP_000489630.1.35966 WP_000489630.1.36000 WP_000489630.1.36003 WP_000489630.1.3601 WP_000489630.1.36011 WP_000489630.1.36017 WP_000489630.1.36034 WP_000489630.1.36036 WP_000489630.1.36037 WP_000489630.1.36063 WP_000489630.1.36069 WP_000489630.1.36157 WP_000489630.1.36286 WP_000489630.1.36291 WP_000489630.1.36298 WP_000489630.1.36308 WP_000489630.1.36323 WP_000489630.1.36343 WP_000489630.1.36409 WP_000489630.1.36445 WP_000489630.1.36460 WP_000489630.1.3649 WP_000489630.1.36495 WP_000489630.1.36512 WP_000489630.1.36526 WP_000489630.1.36547 WP_000489630.1.36567 WP_000489630.1.36579 WP_000489630.1.36584 WP_000489630.1.36609 WP_000489630.1.36617 WP_000489630.1.36618 WP_000489630.1.36643 WP_000489630.1.36663 WP_000489630.1.36685 WP_000489630.1.36690 WP_000489630.1.3670 WP_000489630.1.36701 WP_000489630.1.36705 WP_000489630.1.36721 WP_000489630.1.36725 WP_000489630.1.36751 WP_000489630.1.36764 WP_000489630.1.36779 WP_000489630.1.36798 WP_000489630.1.36802 WP_000489630.1.36821 WP_000489630.1.36839 WP_000489630.1.36853 WP_000489630.1.36889 WP_000489630.1.36918 WP_000489630.1.36931 WP_000489630.1.36949 WP_000489630.1.36950 WP_000489630.1.36978 WP_000489630.1.37013 WP_000489630.1.37014 WP_000489630.1.37029 WP_000489630.1.37063 WP_000489630.1.37073 WP_000489630.1.37111 WP_000489630.1.37112 WP_000489630.1.37114 WP_000489630.1.37133 WP_000489630.1.37176 WP_000489630.1.37190 WP_000489630.1.37191 WP_000489630.1.37199 WP_000489630.1.37200 WP_000489630.1.37256 WP_000489630.1.37258 WP_000489630.1.3726 WP_000489630.1.37267 WP_000489630.1.37293 WP_000489630.1.37297 WP_000489630.1.37303 WP_000489630.1.37351 WP_000489630.1.37370 WP_000489630.1.37376 WP_000489630.1.37405 WP_000489630.1.3744 WP_000489630.1.37478 WP_000489630.1.3748 WP_000489630.1.37498 WP_000489630.1.37504 WP_000489630.1.3751 WP_000489630.1.37513 WP_000489630.1.37521 WP_000489630.1.37558 WP_000489630.1.3756 WP_000489630.1.37584 WP_000489630.1.37590 WP_000489630.1.37593 WP_000489630.1.37600 WP_000489630.1.37613 WP_000489630.1.37618 WP_000489630.1.37659 WP_000489630.1.37662 WP_000489630.1.37666 WP_000489630.1.37675 WP_000489630.1.37687 WP_000489630.1.37691 WP_000489630.1.3771 WP_000489630.1.37761 WP_000489630.1.37775 WP_000489630.1.37777 WP_000489630.1.3778 WP_000489630.1.378 WP_000489630.1.37864 WP_000489630.1.379 WP_000489630.1.3790 WP_000489630.1.37911 WP_000489630.1.37941 WP_000489630.1.37965 WP_000489630.1.37968 WP_000489630.1.37978 WP_000489630.1.37985 WP_000489630.1.38001 WP_000489630.1.38026 WP_000489630.1.38037 WP_000489630.1.38061 WP_000489630.1.38064 WP_000489630.1.38108 WP_000489630.1.38125 WP_000489630.1.38145 WP_000489630.1.3816 WP_000489630.1.38199 WP_000489630.1.38207 WP_000489630.1.38261 WP_000489630.1.38266 WP_000489630.1.38273 WP_000489630.1.383 WP_000489630.1.38310 WP_000489630.1.38322 WP_000489630.1.3834 WP_000489630.1.38344 WP_000489630.1.38349 WP_000489630.1.38351 WP_000489630.1.3838 WP_000489630.1.38381 WP_000489630.1.38408 WP_000489630.1.38440 WP_000489630.1.3848 WP_000489630.1.38486 WP_000489630.1.38512 WP_000489630.1.38515 WP_000489630.1.38569 WP_000489630.1.38595 WP_000489630.1.3860 WP_000489630.1.38609 WP_000489630.1.38613 WP_000489630.1.38642 WP_000489630.1.38673 WP_000489630.1.3869 WP_000489630.1.38693 WP_000489630.1.38734 WP_000489630.1.38773 WP_000489630.1.38781 WP_000489630.1.38877 WP_000489630.1.38881 WP_000489630.1.38882 WP_000489630.1.38895 WP_000489630.1.3891 WP_000489630.1.38913 WP_000489630.1.38942 WP_000489630.1.38983 WP_000489630.1.38996 WP_000489630.1.39003 WP_000489630.1.39048 WP_000489630.1.39055 WP_000489630.1.39056 WP_000489630.1.39065 WP_000489630.1.3907 WP_000489630.1.39105 WP_000489630.1.39113 WP_000489630.1.39128 WP_000489630.1.39136 WP_000489630.1.3914 WP_000489630.1.39147 WP_000489630.1.39161 WP_000489630.1.39210 WP_000489630.1.39229 WP_000489630.1.39235 WP_000489630.1.39265 WP_000489630.1.39275 WP_000489630.1.3931 WP_000489630.1.39312 WP_000489630.1.39385 WP_000489630.1.39395 WP_000489630.1.39405 WP_000489630.1.39414 WP_000489630.1.39420 WP_000489630.1.39435 WP_000489630.1.39449 WP_000489630.1.39471 WP_000489630.1.39497 WP_000489630.1.39502 WP_000489630.1.39503 WP_000489630.1.39512 WP_000489630.1.39530 WP_000489630.1.39556 WP_000489630.1.39576 WP_000489630.1.39584 WP_000489630.1.39609 WP_000489630.1.39614 WP_000489630.1.39619 WP_000489630.1.39620 WP_000489630.1.39624 WP_000489630.1.39629 WP_000489630.1.39632 WP_000489630.1.39659 WP_000489630.1.39667 WP_000489630.1.39724 WP_000489630.1.39763 WP_000489630.1.39775 WP_000489630.1.39808 WP_000489630.1.39862 WP_000489630.1.39879 WP_000489630.1.39890 WP_000489630.1.39921 WP_000489630.1.39923 WP_000489630.1.39941 WP_000489630.1.39945 WP_000489630.1.39947 WP_000489630.1.40017 WP_000489630.1.40025 WP_000489630.1.40072 WP_000489630.1.40073 WP_000489630.1.40081 WP_000489630.1.40095 WP_000489630.1.40097 WP_000489630.1.401 WP_000489630.1.4011 WP_000489630.1.40111 WP_000489630.1.40158 WP_000489630.1.40160 WP_000489630.1.40167 WP_000489630.1.40170 WP_000489630.1.40208 WP_000489630.1.40224 WP_000489630.1.40229 WP_000489630.1.40240 WP_000489630.1.40254 WP_000489630.1.40257 WP_000489630.1.40258 WP_000489630.1.40279 WP_000489630.1.40284 WP_000489630.1.40292 WP_000489630.1.40305 WP_000489630.1.40307 WP_000489630.1.40341 WP_000489630.1.40361 WP_000489630.1.40374 WP_000489630.1.40380 WP_000489630.1.40395 WP_000489630.1.4042 WP_000489630.1.40465 WP_000489630.1.40467 WP_000489630.1.40493 WP_000489630.1.40496 WP_000489630.1.40508 WP_000489630.1.40517 WP_000489630.1.40528 WP_000489630.1.40533 WP_000489630.1.40577 WP_000489630.1.40622 WP_000489630.1.40648 WP_000489630.1.40695 WP_000489630.1.40698 WP_000489630.1.40710 WP_000489630.1.40722 WP_000489630.1.40745 WP_000489630.1.4075 WP_000489630.1.40750 WP_000489630.1.40763 WP_000489630.1.40771 WP_000489630.1.40788 WP_000489630.1.40849 WP_000489630.1.40854 WP_000489630.1.4087 WP_000489630.1.40877 WP_000489630.1.4089 WP_000489630.1.40924 WP_000489630.1.40930 WP_000489630.1.40932 WP_000489630.1.40946 WP_000489630.1.40973 WP_000489630.1.40979 WP_000489630.1.40996 WP_000489630.1.41004 WP_000489630.1.41017 WP_000489630.1.41018 WP_000489630.1.41048 WP_000489630.1.41050 WP_000489630.1.4106 WP_000489630.1.41070 WP_000489630.1.41074 WP_000489630.1.41075 WP_000489630.1.41086 WP_000489630.1.41091 WP_000489630.1.41097 WP_000489630.1.41116 WP_000489630.1.41128 WP_000489630.1.41132 WP_000489630.1.41176 WP_000489630.1.41192 WP_000489630.1.41226 WP_000489630.1.41251 WP_000489630.1.41258 WP_000489630.1.41277 WP_000489630.1.41279 WP_000489630.1.41299 WP_000489630.1.41305 WP_000489630.1.41310 WP_000489630.1.41321 WP_000489630.1.41333 WP_000489630.1.41335 WP_000489630.1.41345 WP_000489630.1.4136 WP_000489630.1.4141 WP_000489630.1.41415 WP_000489630.1.41427 WP_000489630.1.41434 WP_000489630.1.41438 WP_000489630.1.41440 WP_000489630.1.41459 WP_000489630.1.41498 WP_000489630.1.41516 WP_000489630.1.41519 WP_000489630.1.41524 WP_000489630.1.41528 WP_000489630.1.41554 WP_000489630.1.41572 WP_000489630.1.41591 WP_000489630.1.41610 WP_000489630.1.41631 WP_000489630.1.41658 WP_000489630.1.41659 WP_000489630.1.41662 WP_000489630.1.41688 WP_000489630.1.41690 WP_000489630.1.41708 WP_000489630.1.41716 WP_000489630.1.41746 WP_000489630.1.41761 WP_000489630.1.4178 WP_000489630.1.41789 WP_000489630.1.41799 WP_000489630.1.41802 WP_000489630.1.41824 WP_000489630.1.41825 WP_000489630.1.41836 WP_000489630.1.41859 WP_000489630.1.41877 WP_000489630.1.41882 WP_000489630.1.41894 WP_000489630.1.41911 WP_000489630.1.41919 WP_000489630.1.41929 WP_000489630.1.4194 WP_000489630.1.41949 WP_000489630.1.41978 WP_000489630.1.41979 WP_000489630.1.41985 WP_000489630.1.41998 WP_000489630.1.42009 WP_000489630.1.42069 WP_000489630.1.42081 WP_000489630.1.42090 WP_000489630.1.42104 WP_000489630.1.42109 WP_000489630.1.42111 WP_000489630.1.42136 WP_000489630.1.42156 WP_000489630.1.42187 WP_000489630.1.422 WP_000489630.1.42200 WP_000489630.1.42219 WP_000489630.1.4222 WP_000489630.1.42243 WP_000489630.1.42244 WP_000489630.1.42248 WP_000489630.1.42257 WP_000489630.1.42261 WP_000489630.1.42262 WP_000489630.1.42263 WP_000489630.1.42276 WP_000489630.1.42320 WP_000489630.1.42322 WP_000489630.1.42328 WP_000489630.1.42342 WP_000489630.1.42349 WP_000489630.1.42364 WP_000489630.1.42371 WP_000489630.1.42379 WP_000489630.1.4239 WP_000489630.1.42391 WP_000489630.1.42392 WP_000489630.1.42399 WP_000489630.1.42422 WP_000489630.1.42444 WP_000489630.1.42489 WP_000489630.1.42491 WP_000489630.1.42539 WP_000489630.1.42595 WP_000489630.1.42603 WP_000489630.1.42605 WP_000489630.1.42650 WP_000489630.1.42655 WP_000489630.1.42666 WP_000489630.1.4267 WP_000489630.1.42675 WP_000489630.1.42676 WP_000489630.1.42683 WP_000489630.1.42685 WP_000489630.1.42701 WP_000489630.1.42707 WP_000489630.1.42734 WP_000489630.1.4276 WP_000489630.1.42767 WP_000489630.1.42794 WP_000489630.1.42797 WP_000489630.1.42805 WP_000489630.1.42815 WP_000489630.1.42829 WP_000489630.1.42859 WP_000489630.1.42861 WP_000489630.1.42864 WP_000489630.1.4288 WP_000489630.1.42887 WP_000489630.1.4289 WP_000489630.1.42892 WP_000489630.1.42923 WP_000489630.1.42932 WP_000489630.1.42957 WP_000489630.1.4298 WP_000489630.1.42981 WP_000489630.1.43008 WP_000489630.1.43016 WP_000489630.1.43018 WP_000489630.1.43019 WP_000489630.1.43041 WP_000489630.1.43065 WP_000489630.1.43068 WP_000489630.1.43069 WP_000489630.1.43070 WP_000489630.1.43077 WP_000489630.1.43086 WP_000489630.1.43141 WP_000489630.1.43157 WP_000489630.1.43160 WP_000489630.1.43161 WP_000489630.1.43190 WP_000489630.1.43198 WP_000489630.1.43201 WP_000489630.1.43244 WP_000489630.1.4326 WP_000489630.1.43276 WP_000489630.1.43290 WP_000489630.1.43292 WP_000489630.1.43299 WP_000489630.1.43307 WP_000489630.1.43312 WP_000489630.1.43334 WP_000489630.1.43339 WP_000489630.1.43351 WP_000489630.1.43371 WP_000489630.1.43437 WP_000489630.1.43438 WP_000489630.1.4344 WP_000489630.1.43441 WP_000489630.1.43476 WP_000489630.1.43508 WP_000489630.1.43513 WP_000489630.1.43520 WP_000489630.1.43522 WP_000489630.1.43528 WP_000489630.1.43535 WP_000489630.1.43606 WP_000489630.1.43613 WP_000489630.1.43633 WP_000489630.1.43637 WP_000489630.1.43651 WP_000489630.1.43668 WP_000489630.1.43685 WP_000489630.1.43710 WP_000489630.1.43711 WP_000489630.1.4373 WP_000489630.1.43778 WP_000489630.1.43785 WP_000489630.1.43801 WP_000489630.1.43812 WP_000489630.1.43839 WP_000489630.1.43875 WP_000489630.1.43878 WP_000489630.1.43886 WP_000489630.1.43888 WP_000489630.1.43919 WP_000489630.1.43951 WP_000489630.1.43974 WP_000489630.1.44043 WP_000489630.1.44049 WP_000489630.1.4405 WP_000489630.1.44099 WP_000489630.1.44101 WP_000489630.1.44113 WP_000489630.1.44121 WP_000489630.1.44132 WP_000489630.1.44160 WP_000489630.1.44180 WP_000489630.1.44187 WP_000489630.1.44191 WP_000489630.1.44196 WP_000489630.1.44248 WP_000489630.1.44250 WP_000489630.1.44262 WP_000489630.1.44268 WP_000489630.1.4427 WP_000489630.1.44296 WP_000489630.1.44300 WP_000489630.1.44310 WP_000489630.1.44337 WP_000489630.1.44351 WP_000489630.1.44360 WP_000489630.1.44397 WP_000489630.1.4440 WP_000489630.1.44416 WP_000489630.1.44431 WP_000489630.1.44433 WP_000489630.1.44437 WP_000489630.1.44438 WP_000489630.1.44440 WP_000489630.1.44443 WP_000489630.1.44474 WP_000489630.1.44479 WP_000489630.1.44546 WP_000489630.1.44578 WP_000489630.1.44607 WP_000489630.1.44633 WP_000489630.1.44640 WP_000489630.1.4467 WP_000489630.1.44678 WP_000489630.1.4468 WP_000489630.1.44705 WP_000489630.1.44747 WP_000489630.1.44762 WP_000489630.1.44781 WP_000489630.1.44815 WP_000489630.1.44828 WP_000489630.1.44831 WP_000489630.1.44833 WP_000489630.1.4485 WP_000489630.1.44877 WP_000489630.1.44879 WP_000489630.1.44887 WP_000489630.1.449 WP_000489630.1.44917 WP_000489630.1.44927 WP_000489630.1.44933 WP_000489630.1.44950 WP_000489630.1.44966 WP_000489630.1.44971 WP_000489630.1.44978 WP_000489630.1.44997 WP_000489630.1.44998 WP_000489630.1.4500 WP_000489630.1.4501 WP_000489630.1.45038 WP_000489630.1.45045 WP_000489630.1.45067 WP_000489630.1.45072 WP_000489630.1.45074 WP_000489630.1.45079 WP_000489630.1.45093 WP_000489630.1.45098 WP_000489630.1.45123 WP_000489630.1.45136 WP_000489630.1.45145 WP_000489630.1.45173 WP_000489630.1.45177 WP_000489630.1.45184 WP_000489630.1.45241 WP_000489630.1.45259 WP_000489630.1.45302 WP_000489630.1.4531 WP_000489630.1.45322 WP_000489630.1.45344 WP_000489630.1.45349 WP_000489630.1.45365 WP_000489630.1.4540 WP_000489630.1.45432 WP_000489630.1.45434 WP_000489630.1.45435 WP_000489630.1.45523 WP_000489630.1.45535 WP_000489630.1.45544 WP_000489630.1.45549 WP_000489630.1.45550 WP_000489630.1.45569 WP_000489630.1.45571 WP_000489630.1.45582 WP_000489630.1.45583 WP_000489630.1.45585 WP_000489630.1.45596 WP_000489630.1.45622 WP_000489630.1.45648 WP_000489630.1.45660 WP_000489630.1.45690 WP_000489630.1.45706 WP_000489630.1.45781 WP_000489630.1.45797 WP_000489630.1.458 WP_000489630.1.45829 WP_000489630.1.45844 WP_000489630.1.45848 WP_000489630.1.45871 WP_000489630.1.45906 WP_000489630.1.45918 WP_000489630.1.4592 WP_000489630.1.46011 WP_000489630.1.46028 WP_000489630.1.46030 WP_000489630.1.46069 WP_000489630.1.46077 WP_000489630.1.46091 WP_000489630.1.46112 WP_000489630.1.46169 WP_000489630.1.46173 WP_000489630.1.46174 WP_000489630.1.46187 WP_000489630.1.46203 WP_000489630.1.46205 WP_000489630.1.46215 WP_000489630.1.46225 WP_000489630.1.46232 WP_000489630.1.46241 WP_000489630.1.46243 WP_000489630.1.46250 WP_000489630.1.46278 WP_000489630.1.46286 WP_000489630.1.46303 WP_000489630.1.46307 WP_000489630.1.46322 WP_000489630.1.46323 WP_000489630.1.46345 WP_000489630.1.46355 WP_000489630.1.464 WP_000489630.1.46406 WP_000489630.1.46434 WP_000489630.1.46444 WP_000489630.1.46454 WP_000489630.1.46461 WP_000489630.1.46504 WP_000489630.1.46505 WP_000489630.1.46572 WP_000489630.1.46574 WP_000489630.1.46578 WP_000489630.1.46595 WP_000489630.1.46620 WP_000489630.1.46666 WP_000489630.1.46675 WP_000489630.1.46689 WP_000489630.1.46693 WP_000489630.1.46701 WP_000489630.1.4671 WP_000489630.1.46726 WP_000489630.1.46730 WP_000489630.1.46732 WP_000489630.1.4674 WP_000489630.1.46749 WP_000489630.1.46781 WP_000489630.1.46803 WP_000489630.1.46816 WP_000489630.1.46842 WP_000489630.1.4686 WP_000489630.1.4690 WP_000489630.1.46920 WP_000489630.1.46930 WP_000489630.1.46945 WP_000489630.1.46961 WP_000489630.1.46967 WP_000489630.1.46976 WP_000489630.1.47008 WP_000489630.1.47036 WP_000489630.1.47037 WP_000489630.1.47042 WP_000489630.1.47057 WP_000489630.1.47059 WP_000489630.1.47067 WP_000489630.1.47085 WP_000489630.1.47123 WP_000489630.1.47214 WP_000489630.1.47215 WP_000489630.1.47257 WP_000489630.1.47429 WP_000489630.1.47448 WP_000489630.1.4747 WP_000489630.1.47472 WP_000489630.1.47478 WP_000489630.1.47506 WP_000489630.1.47507 WP_000489630.1.47523 WP_000489630.1.47531 WP_000489630.1.47532 WP_000489630.1.47567 WP_000489630.1.47576 WP_000489630.1.47579 WP_000489630.1.4758 WP_000489630.1.47587 WP_000489630.1.47605 WP_000489630.1.47621 WP_000489630.1.47630 WP_000489630.1.47649 WP_000489630.1.4770 WP_000489630.1.47714 WP_000489630.1.4774 WP_000489630.1.4775 WP_000489630.1.47756 WP_000489630.1.47799 WP_000489630.1.4781 WP_000489630.1.47814 WP_000489630.1.47817 WP_000489630.1.47829 WP_000489630.1.47849 WP_000489630.1.47850 WP_000489630.1.47875 WP_000489630.1.47886 WP_000489630.1.47898 WP_000489630.1.47902 WP_000489630.1.47911 WP_000489630.1.47928 WP_000489630.1.4795 WP_000489630.1.47988 WP_000489630.1.47992 WP_000489630.1.48019 WP_000489630.1.48100 WP_000489630.1.48114 WP_000489630.1.48124 WP_000489630.1.48132 WP_000489630.1.48139 WP_000489630.1.48190 WP_000489630.1.48209 WP_000489630.1.48215 WP_000489630.1.48218 WP_000489630.1.48242 WP_000489630.1.48247 WP_000489630.1.48253 WP_000489630.1.48268 WP_000489630.1.48292 WP_000489630.1.483 WP_000489630.1.48324 WP_000489630.1.48367 WP_000489630.1.48377 WP_000489630.1.4839 WP_000489630.1.48426 WP_000489630.1.48430 WP_000489630.1.48436 WP_000489630.1.48455 WP_000489630.1.48493 WP_000489630.1.48524 WP_000489630.1.4853 WP_000489630.1.48570 WP_000489630.1.48586 WP_000489630.1.4859 WP_000489630.1.48591 WP_000489630.1.48610 WP_000489630.1.48631 WP_000489630.1.48651 WP_000489630.1.48663 WP_000489630.1.48690 WP_000489630.1.48734 WP_000489630.1.48755 WP_000489630.1.48756 WP_000489630.1.48778 WP_000489630.1.48788 WP_000489630.1.48797 WP_000489630.1.48849 WP_000489630.1.4885 WP_000489630.1.48855 WP_000489630.1.48876 WP_000489630.1.48886 WP_000489630.1.48894 WP_000489630.1.48919 WP_000489630.1.48931 WP_000489630.1.48955 WP_000489630.1.48963 WP_000489630.1.48973 WP_000489630.1.48985 WP_000489630.1.49004 WP_000489630.1.49012 WP_000489630.1.49084 WP_000489630.1.49102 WP_000489630.1.49106 WP_000489630.1.49113 WP_000489630.1.49117 WP_000489630.1.49121 WP_000489630.1.49140 WP_000489630.1.49153 WP_000489630.1.49155 WP_000489630.1.49166 WP_000489630.1.49175 WP_000489630.1.49204 WP_000489630.1.49226 WP_000489630.1.49233 WP_000489630.1.49239 WP_000489630.1.49256 WP_000489630.1.49262 WP_000489630.1.49276 WP_000489630.1.49290 WP_000489630.1.49304 WP_000489630.1.49309 WP_000489630.1.49311 WP_000489630.1.49334 WP_000489630.1.49340 WP_000489630.1.49366 WP_000489630.1.49429 WP_000489630.1.49434 WP_000489630.1.49450 WP_000489630.1.49472 WP_000489630.1.49490 WP_000489630.1.495 WP_000489630.1.49515 WP_000489630.1.49545 WP_000489630.1.49550 WP_000489630.1.49572 WP_000489630.1.49590 WP_000489630.1.49626 WP_000489630.1.49686 WP_000489630.1.49703 WP_000489630.1.49769 WP_000489630.1.49770 WP_000489630.1.49780 WP_000489630.1.4979 WP_000489630.1.49803 WP_000489630.1.49805 WP_000489630.1.49846 WP_000489630.1.4991 WP_000489630.1.49929 WP_000489630.1.49931 WP_000489630.1.49947 WP_000489630.1.49959 WP_000489630.1.49997 WP_000489630.1.50 WP_000489630.1.50003 WP_000489630.1.50007 WP_000489630.1.50014 WP_000489630.1.50030 WP_000489630.1.50043 WP_000489630.1.50080 WP_000489630.1.5009 WP_000489630.1.50103 WP_000489630.1.50128 WP_000489630.1.50158 WP_000489630.1.50161 WP_000489630.1.50211 WP_000489630.1.50239 WP_000489630.1.50247 WP_000489630.1.50251 WP_000489630.1.50285 WP_000489630.1.50308 WP_000489630.1.50309 WP_000489630.1.50332 WP_000489630.1.50374 WP_000489630.1.50376 WP_000489630.1.50386 WP_000489630.1.50387 WP_000489630.1.50389 WP_000489630.1.50404 WP_000489630.1.50406 WP_000489630.1.50413 WP_000489630.1.50449 WP_000489630.1.50468 WP_000489630.1.50469 WP_000489630.1.5051 WP_000489630.1.50517 WP_000489630.1.50563 WP_000489630.1.50565 WP_000489630.1.50566 WP_000489630.1.50570 WP_000489630.1.50593 WP_000489630.1.50626 WP_000489630.1.50652 WP_000489630.1.50676 WP_000489630.1.50684 WP_000489630.1.50726 WP_000489630.1.50769 WP_000489630.1.50771 WP_000489630.1.50774 WP_000489630.1.50782 WP_000489630.1.50804 WP_000489630.1.50808 WP_000489630.1.50875 WP_000489630.1.5088 WP_000489630.1.50882 WP_000489630.1.509 WP_000489630.1.50905 WP_000489630.1.50908 WP_000489630.1.50929 WP_000489630.1.50941 WP_000489630.1.50960 WP_000489630.1.50970 WP_000489630.1.50999 WP_000489630.1.51014 WP_000489630.1.51022 WP_000489630.1.51025 WP_000489630.1.51040 WP_000489630.1.51048 WP_000489630.1.51066 WP_000489630.1.51100 WP_000489630.1.51131 WP_000489630.1.51134 WP_000489630.1.51139 WP_000489630.1.51162 WP_000489630.1.51179 WP_000489630.1.51182 WP_000489630.1.51186 WP_000489630.1.51224 WP_000489630.1.51227 WP_000489630.1.5127 WP_000489630.1.51285 WP_000489630.1.51305 WP_000489630.1.51308 WP_000489630.1.51315 WP_000489630.1.51331 WP_000489630.1.51356 WP_000489630.1.5136 WP_000489630.1.51394 WP_000489630.1.51412 WP_000489630.1.51414 WP_000489630.1.51451 WP_000489630.1.51464 WP_000489630.1.51474 WP_000489630.1.51487 WP_000489630.1.51488 WP_000489630.1.51502 WP_000489630.1.51506 WP_000489630.1.51514 WP_000489630.1.51518 WP_000489630.1.51519 WP_000489630.1.51555 WP_000489630.1.51594 WP_000489630.1.51598 WP_000489630.1.51611 WP_000489630.1.51613 WP_000489630.1.51634 WP_000489630.1.51642 WP_000489630.1.51644 WP_000489630.1.51649 WP_000489630.1.51686 WP_000489630.1.51700 WP_000489630.1.51724 WP_000489630.1.51734 WP_000489630.1.51756 WP_000489630.1.51764 WP_000489630.1.51810 WP_000489630.1.51831 WP_000489630.1.51838 WP_000489630.1.51841 WP_000489630.1.51863 WP_000489630.1.51868 WP_000489630.1.51911 WP_000489630.1.51914 WP_000489630.1.51930 WP_000489630.1.51932 WP_000489630.1.51935 WP_000489630.1.51989 WP_000489630.1.51994 WP_000489630.1.520 WP_000489630.1.52047 WP_000489630.1.52057 WP_000489630.1.5211 WP_000489630.1.52114 WP_000489630.1.52121 WP_000489630.1.52129 WP_000489630.1.52148 WP_000489630.1.52156 WP_000489630.1.5216 WP_000489630.1.52191 WP_000489630.1.52202 WP_000489630.1.52209 WP_000489630.1.52255 WP_000489630.1.52301 WP_000489630.1.52321 WP_000489630.1.52336 WP_000489630.1.52339 WP_000489630.1.52346 WP_000489630.1.52353 WP_000489630.1.52356 WP_000489630.1.52438 WP_000489630.1.52469 WP_000489630.1.52527 WP_000489630.1.52528 WP_000489630.1.52571 WP_000489630.1.52582 WP_000489630.1.52586 WP_000489630.1.526 WP_000489630.1.52647 WP_000489630.1.52653 WP_000489630.1.52656 WP_000489630.1.52692 WP_000489630.1.52742 WP_000489630.1.52743 WP_000489630.1.52744 WP_000489630.1.52748 WP_000489630.1.52773 WP_000489630.1.52795 WP_000489630.1.52807 WP_000489630.1.52833 WP_000489630.1.52857 WP_000489630.1.52866 WP_000489630.1.52887 WP_000489630.1.52898 WP_000489630.1.52915 WP_000489630.1.52949 WP_000489630.1.53016 WP_000489630.1.53092 WP_000489630.1.53107 WP_000489630.1.53119 WP_000489630.1.5313 WP_000489630.1.53141 WP_000489630.1.53151 WP_000489630.1.53154 WP_000489630.1.53159 WP_000489630.1.53190 WP_000489630.1.53198 WP_000489630.1.53203 WP_000489630.1.53206 WP_000489630.1.53210 WP_000489630.1.53233 WP_000489630.1.53234 WP_000489630.1.53272 WP_000489630.1.53286 WP_000489630.1.53307 WP_000489630.1.53316 WP_000489630.1.53321 WP_000489630.1.53362 WP_000489630.1.53368 WP_000489630.1.53375 WP_000489630.1.53385 WP_000489630.1.53406 WP_000489630.1.53436 WP_000489630.1.53450 WP_000489630.1.53454 WP_000489630.1.53466 WP_000489630.1.5349 WP_000489630.1.53529 WP_000489630.1.53534 WP_000489630.1.53540 WP_000489630.1.53543 WP_000489630.1.53555 WP_000489630.1.53559 WP_000489630.1.5356 WP_000489630.1.53567 WP_000489630.1.53571 WP_000489630.1.5358 WP_000489630.1.53664 WP_000489630.1.53688 WP_000489630.1.53692 WP_000489630.1.53694 WP_000489630.1.53696 WP_000489630.1.53723 WP_000489630.1.5374 WP_000489630.1.53750 WP_000489630.1.53757 WP_000489630.1.53772 WP_000489630.1.53781 WP_000489630.1.53800 WP_000489630.1.53812 WP_000489630.1.53815 WP_000489630.1.53839 WP_000489630.1.53892 WP_000489630.1.53896 WP_000489630.1.53902 WP_000489630.1.53905 WP_000489630.1.53935 WP_000489630.1.53958 WP_000489630.1.53961 WP_000489630.1.53981 WP_000489630.1.53984 WP_000489630.1.54033 WP_000489630.1.54061 WP_000489630.1.54068 WP_000489630.1.54075 WP_000489630.1.54082 WP_000489630.1.54132 WP_000489630.1.54136 WP_000489630.1.54170 WP_000489630.1.54175 WP_000489630.1.54196 WP_000489630.1.542 WP_000489630.1.54203 WP_000489630.1.54209 WP_000489630.1.54259 WP_000489630.1.54271 WP_000489630.1.54273 WP_000489630.1.54274 WP_000489630.1.54283 WP_000489630.1.5430 WP_000489630.1.54319 WP_000489630.1.54364 WP_000489630.1.54366 WP_000489630.1.54371 WP_000489630.1.54400 WP_000489630.1.54431 WP_000489630.1.54442 WP_000489630.1.54469 WP_000489630.1.54482 WP_000489630.1.54522 WP_000489630.1.54526 WP_000489630.1.5456 WP_000489630.1.54569 WP_000489630.1.54589 WP_000489630.1.54607 WP_000489630.1.54615 WP_000489630.1.54644 WP_000489630.1.54662 WP_000489630.1.54667 WP_000489630.1.54678 WP_000489630.1.54681 WP_000489630.1.54694 WP_000489630.1.54722 WP_000489630.1.54748 WP_000489630.1.54749 WP_000489630.1.54764 WP_000489630.1.5481 WP_000489630.1.54814 WP_000489630.1.54827 WP_000489630.1.54833 WP_000489630.1.54845 WP_000489630.1.5485 WP_000489630.1.54865 WP_000489630.1.54877 WP_000489630.1.54935 WP_000489630.1.54936 WP_000489630.1.54979 WP_000489630.1.54984 WP_000489630.1.54992 WP_000489630.1.55008 WP_000489630.1.55010 WP_000489630.1.55034 WP_000489630.1.55073 WP_000489630.1.55152 WP_000489630.1.55156 WP_000489630.1.55163 WP_000489630.1.55165 WP_000489630.1.5517 WP_000489630.1.55215 WP_000489630.1.55223 WP_000489630.1.55224 WP_000489630.1.5523 WP_000489630.1.55285 WP_000489630.1.55294 WP_000489630.1.55310 WP_000489630.1.55317 WP_000489630.1.55325 WP_000489630.1.55379 WP_000489630.1.5539 WP_000489630.1.55418 WP_000489630.1.55430 WP_000489630.1.55461 WP_000489630.1.55468 WP_000489630.1.55475 WP_000489630.1.55477 WP_000489630.1.55496 WP_000489630.1.5555 WP_000489630.1.55554 WP_000489630.1.55557 WP_000489630.1.55559 WP_000489630.1.5560 WP_000489630.1.55604 WP_000489630.1.55614 WP_000489630.1.55623 WP_000489630.1.55639 WP_000489630.1.55640 WP_000489630.1.55647 WP_000489630.1.55672 WP_000489630.1.55699 WP_000489630.1.55706 WP_000489630.1.55718 WP_000489630.1.5572 WP_000489630.1.55725 WP_000489630.1.55743 WP_000489630.1.55768 WP_000489630.1.5577 WP_000489630.1.55780 WP_000489630.1.55782 WP_000489630.1.55796 WP_000489630.1.55853 WP_000489630.1.55923 WP_000489630.1.55948 WP_000489630.1.55967 WP_000489630.1.55973 WP_000489630.1.55993 WP_000489630.1.56002 WP_000489630.1.56012 WP_000489630.1.56026 WP_000489630.1.56097 WP_000489630.1.56105 WP_000489630.1.56144 WP_000489630.1.56172 WP_000489630.1.5621 WP_000489630.1.56222 WP_000489630.1.56226 WP_000489630.1.56235 WP_000489630.1.56238 WP_000489630.1.56244 WP_000489630.1.56247 WP_000489630.1.56261 WP_000489630.1.56263 WP_000489630.1.56286 WP_000489630.1.56303 WP_000489630.1.56304 WP_000489630.1.56305 WP_000489630.1.56311 WP_000489630.1.56354 WP_000489630.1.56368 WP_000489630.1.56370 WP_000489630.1.56385 WP_000489630.1.56389 WP_000489630.1.56393 WP_000489630.1.56414 WP_000489630.1.56419 WP_000489630.1.56423 WP_000489630.1.56438 WP_000489630.1.56514 WP_000489630.1.56535 WP_000489630.1.56559 WP_000489630.1.56560 WP_000489630.1.56585 WP_000489630.1.56597 WP_000489630.1.56601 WP_000489630.1.56614 WP_000489630.1.56615 WP_000489630.1.56640 WP_000489630.1.56647 WP_000489630.1.56651 WP_000489630.1.56660 WP_000489630.1.56671 WP_000489630.1.5668 WP_000489630.1.56682 WP_000489630.1.56724 WP_000489630.1.56825 WP_000489630.1.56851 WP_000489630.1.56853 WP_000489630.1.56861 WP_000489630.1.56875 WP_000489630.1.56877 WP_000489630.1.56887 WP_000489630.1.56889 WP_000489630.1.56893 WP_000489630.1.56898 WP_000489630.1.56905 WP_000489630.1.56950 WP_000489630.1.56981 WP_000489630.1.57000 WP_000489630.1.57026 WP_000489630.1.57039 WP_000489630.1.57056 WP_000489630.1.57084 WP_000489630.1.57101 WP_000489630.1.5711 WP_000489630.1.57125 WP_000489630.1.57143 WP_000489630.1.57147 WP_000489630.1.57149 WP_000489630.1.57168 WP_000489630.1.57179 WP_000489630.1.57186 WP_000489630.1.57187 WP_000489630.1.57232 WP_000489630.1.57233 WP_000489630.1.57246 WP_000489630.1.57296 WP_000489630.1.57307 WP_000489630.1.57342 WP_000489630.1.57356 WP_000489630.1.57357 WP_000489630.1.57362 WP_000489630.1.57377 WP_000489630.1.57399 WP_000489630.1.57418 WP_000489630.1.57433 WP_000489630.1.57510 WP_000489630.1.57515 WP_000489630.1.57529 WP_000489630.1.57534 WP_000489630.1.57555 WP_000489630.1.57559 WP_000489630.1.57576 WP_000489630.1.57601 WP_000489630.1.57607 WP_000489630.1.57631 WP_000489630.1.57641 WP_000489630.1.57684 WP_000489630.1.57699 WP_000489630.1.5774 WP_000489630.1.57763 WP_000489630.1.57781 WP_000489630.1.57785 WP_000489630.1.57800 WP_000489630.1.5781 WP_000489630.1.57835 WP_000489630.1.57862 WP_000489630.1.57873 WP_000489630.1.57890 WP_000489630.1.57891 WP_000489630.1.57893 WP_000489630.1.57965 WP_000489630.1.57972 WP_000489630.1.58008 WP_000489630.1.5801 WP_000489630.1.58040 WP_000489630.1.58041 WP_000489630.1.58044 WP_000489630.1.58081 WP_000489630.1.5809 WP_000489630.1.58090 WP_000489630.1.58132 WP_000489630.1.58144 WP_000489630.1.58153 WP_000489630.1.58157 WP_000489630.1.58173 WP_000489630.1.58191 WP_000489630.1.58194 WP_000489630.1.58249 WP_000489630.1.58252 WP_000489630.1.58261 WP_000489630.1.58274 WP_000489630.1.5828 WP_000489630.1.58290 WP_000489630.1.58301 WP_000489630.1.58324 WP_000489630.1.58326 WP_000489630.1.58358 WP_000489630.1.5836 WP_000489630.1.58372 WP_000489630.1.58407 WP_000489630.1.58418 WP_000489630.1.58442 WP_000489630.1.58443 WP_000489630.1.58485 WP_000489630.1.58486 WP_000489630.1.58489 WP_000489630.1.58537 WP_000489630.1.5854 WP_000489630.1.58548 WP_000489630.1.58564 WP_000489630.1.58568 WP_000489630.1.5858 WP_000489630.1.58583 WP_000489630.1.58604 WP_000489630.1.58652 WP_000489630.1.58662 WP_000489630.1.58663 WP_000489630.1.58669 WP_000489630.1.58675 WP_000489630.1.58698 WP_000489630.1.587 WP_000489630.1.58724 WP_000489630.1.58729 WP_000489630.1.58745 WP_000489630.1.58749 WP_000489630.1.5875 WP_000489630.1.5878 WP_000489630.1.58796 WP_000489630.1.58803 WP_000489630.1.58807 WP_000489630.1.58831 WP_000489630.1.58834 WP_000489630.1.58836 WP_000489630.1.58847 WP_000489630.1.5886 WP_000489630.1.58861 WP_000489630.1.58883 WP_000489630.1.58884 WP_000489630.1.58898 WP_000489630.1.58926 WP_000489630.1.58932 WP_000489630.1.58949 WP_000489630.1.58963 WP_000489630.1.58970 WP_000489630.1.58974 WP_000489630.1.59020 WP_000489630.1.59043 WP_000489630.1.59056 WP_000489630.1.59061 WP_000489630.1.59064 WP_000489630.1.59084 WP_000489630.1.59094 WP_000489630.1.59097 WP_000489630.1.59136 WP_000489630.1.59142 WP_000489630.1.59163 WP_000489630.1.59224 WP_000489630.1.59236 WP_000489630.1.59282 WP_000489630.1.59294 WP_000489630.1.59299 WP_000489630.1.59313 WP_000489630.1.59335 WP_000489630.1.59336 WP_000489630.1.59375 WP_000489630.1.59381 WP_000489630.1.59412 WP_000489630.1.59420 WP_000489630.1.59427 WP_000489630.1.59439 WP_000489630.1.59458 WP_000489630.1.5949 WP_000489630.1.59490 WP_000489630.1.59501 WP_000489630.1.59508 WP_000489630.1.59510 WP_000489630.1.59512 WP_000489630.1.59521 WP_000489630.1.5953 WP_000489630.1.59538 WP_000489630.1.59548 WP_000489630.1.59641 WP_000489630.1.59646 WP_000489630.1.59648 WP_000489630.1.59684 WP_000489630.1.5969 WP_000489630.1.59694 WP_000489630.1.59710 WP_000489630.1.59751 WP_000489630.1.59771 WP_000489630.1.5979 WP_000489630.1.59827 WP_000489630.1.59829 WP_000489630.1.59830 WP_000489630.1.59847 WP_000489630.1.59848 WP_000489630.1.59863 WP_000489630.1.59928 WP_000489630.1.5993 WP_000489630.1.59953 WP_000489630.1.59969 WP_000489630.1.59994 WP_000489630.1.60004 WP_000489630.1.60008 WP_000489630.1.60015 WP_000489630.1.60021 WP_000489630.1.60045 WP_000489630.1.60052 WP_000489630.1.60069 WP_000489630.1.60076 WP_000489630.1.60106 WP_000489630.1.60114 WP_000489630.1.60126 WP_000489630.1.60137 WP_000489630.1.60140 WP_000489630.1.60155 WP_000489630.1.60168 WP_000489630.1.60192 WP_000489630.1.60199 WP_000489630.1.60209 WP_000489630.1.60212 WP_000489630.1.60213 WP_000489630.1.60226 WP_000489630.1.60231 WP_000489630.1.60253 WP_000489630.1.60285 WP_000489630.1.60320 WP_000489630.1.60322 WP_000489630.1.60324 WP_000489630.1.6033 WP_000489630.1.60356 WP_000489630.1.60370 WP_000489630.1.60379 WP_000489630.1.6038 WP_000489630.1.60380 WP_000489630.1.6041 WP_000489630.1.60424 WP_000489630.1.60425 WP_000489630.1.60464 WP_000489630.1.60481 WP_000489630.1.605 WP_000489630.1.60507 WP_000489630.1.6052 WP_000489630.1.60545 WP_000489630.1.60560 WP_000489630.1.60561 WP_000489630.1.6058 WP_000489630.1.60584 WP_000489630.1.60597 WP_000489630.1.6060 WP_000489630.1.60608 WP_000489630.1.60643 WP_000489630.1.60661 WP_000489630.1.60676 WP_000489630.1.60708 WP_000489630.1.60713 WP_000489630.1.60725 WP_000489630.1.60746 WP_000489630.1.60772 WP_000489630.1.60783 WP_000489630.1.60792 WP_000489630.1.60794 WP_000489630.1.608 WP_000489630.1.60807 WP_000489630.1.60838 WP_000489630.1.6086 WP_000489630.1.60866 WP_000489630.1.60874 WP_000489630.1.60882 WP_000489630.1.60889 WP_000489630.1.60897 WP_000489630.1.60919 WP_000489630.1.60941 WP_000489630.1.60950 WP_000489630.1.60976 WP_000489630.1.6104 WP_000489630.1.61044 WP_000489630.1.61045 WP_000489630.1.61076 WP_000489630.1.61078 WP_000489630.1.6108 WP_000489630.1.61087 WP_000489630.1.61123 WP_000489630.1.6114 WP_000489630.1.61146 WP_000489630.1.61147 WP_000489630.1.61168 WP_000489630.1.61210 WP_000489630.1.61218 WP_000489630.1.61232 WP_000489630.1.61233 WP_000489630.1.6129 WP_000489630.1.61296 WP_000489630.1.61345 WP_000489630.1.61356 WP_000489630.1.61357 WP_000489630.1.61381 WP_000489630.1.61417 WP_000489630.1.61497 WP_000489630.1.61501 WP_000489630.1.61509 WP_000489630.1.61511 WP_000489630.1.61539 WP_000489630.1.61542 WP_000489630.1.61553 WP_000489630.1.61574 WP_000489630.1.61582 WP_000489630.1.61594 WP_000489630.1.61595 WP_000489630.1.61609 WP_000489630.1.6164 WP_000489630.1.61649 WP_000489630.1.61652 WP_000489630.1.61662 WP_000489630.1.61671 WP_000489630.1.61697 WP_000489630.1.61712 WP_000489630.1.61714 WP_000489630.1.61730 WP_000489630.1.61743 WP_000489630.1.61783 WP_000489630.1.61809 WP_000489630.1.61857 WP_000489630.1.61877 WP_000489630.1.61908 WP_000489630.1.61920 WP_000489630.1.61922 WP_000489630.1.61924 WP_000489630.1.61952 WP_000489630.1.61968 WP_000489630.1.62007 WP_000489630.1.62020 WP_000489630.1.62025 WP_000489630.1.62076 WP_000489630.1.6209 WP_000489630.1.6210 WP_000489630.1.62122 WP_000489630.1.62124 WP_000489630.1.62158 WP_000489630.1.62199 WP_000489630.1.62201 WP_000489630.1.62204 WP_000489630.1.62210 WP_000489630.1.62219 WP_000489630.1.62222 WP_000489630.1.62223 WP_000489630.1.62241 WP_000489630.1.62245 WP_000489630.1.62257 WP_000489630.1.62271 WP_000489630.1.62302 WP_000489630.1.62304 WP_000489630.1.62314 WP_000489630.1.62323 WP_000489630.1.62333 WP_000489630.1.62338 WP_000489630.1.62339 WP_000489630.1.62364 WP_000489630.1.62374 WP_000489630.1.62380 WP_000489630.1.62403 WP_000489630.1.62404 WP_000489630.1.62411 WP_000489630.1.62412 WP_000489630.1.62436 WP_000489630.1.62475 WP_000489630.1.62486 WP_000489630.1.62504 WP_000489630.1.62522 WP_000489630.1.6253 WP_000489630.1.62536 WP_000489630.1.62564 WP_000489630.1.62570 WP_000489630.1.62619 WP_000489630.1.62640 WP_000489630.1.62677 WP_000489630.1.62686 WP_000489630.1.627 WP_000489630.1.62745 WP_000489630.1.62751 WP_000489630.1.62757 WP_000489630.1.62798 WP_000489630.1.62825 WP_000489630.1.62853 WP_000489630.1.62903 WP_000489630.1.62910 WP_000489630.1.62913 WP_000489630.1.6292 WP_000489630.1.62932 WP_000489630.1.62955 WP_000489630.1.62960 WP_000489630.1.62976 WP_000489630.1.62983 WP_000489630.1.62988 WP_000489630.1.63016 WP_000489630.1.63025 WP_000489630.1.63043 WP_000489630.1.63045 WP_000489630.1.63063 WP_000489630.1.63069 WP_000489630.1.63087 WP_000489630.1.63102 WP_000489630.1.63118 WP_000489630.1.63135 WP_000489630.1.63150 WP_000489630.1.63169 WP_000489630.1.63181 WP_000489630.1.63186 WP_000489630.1.63203 WP_000489630.1.63229 WP_000489630.1.63234 WP_000489630.1.63243 WP_000489630.1.63250 WP_000489630.1.63256 WP_000489630.1.63290 WP_000489630.1.63297 WP_000489630.1.63358 WP_000489630.1.63382 WP_000489630.1.63422 WP_000489630.1.63432 WP_000489630.1.63448 WP_000489630.1.63461 WP_000489630.1.63479 WP_000489630.1.63497 WP_000489630.1.63499 WP_000489630.1.63509 WP_000489630.1.63514 WP_000489630.1.63525 WP_000489630.1.63529 WP_000489630.1.63532 WP_000489630.1.63568 WP_000489630.1.6357 WP_000489630.1.63577 WP_000489630.1.63583 WP_000489630.1.63585 WP_000489630.1.63592 WP_000489630.1.63603 WP_000489630.1.63663 WP_000489630.1.63664 WP_000489630.1.63677 WP_000489630.1.6370 WP_000489630.1.63718 WP_000489630.1.63736 WP_000489630.1.63748 WP_000489630.1.6375 WP_000489630.1.63757 WP_000489630.1.63766 WP_000489630.1.63781 WP_000489630.1.63797 WP_000489630.1.63816 WP_000489630.1.63824 WP_000489630.1.63831 WP_000489630.1.63834 WP_000489630.1.63851 WP_000489630.1.63863 WP_000489630.1.63876 WP_000489630.1.6389 WP_000489630.1.63901 WP_000489630.1.63903 WP_000489630.1.63934 WP_000489630.1.63955 WP_000489630.1.63963 WP_000489630.1.63977 WP_000489630.1.63992 WP_000489630.1.64007 WP_000489630.1.64010 WP_000489630.1.64018 WP_000489630.1.64032 WP_000489630.1.64046 WP_000489630.1.64085 WP_000489630.1.64087 WP_000489630.1.64121 WP_000489630.1.6415 WP_000489630.1.64157 WP_000489630.1.64208 WP_000489630.1.64229 WP_000489630.1.6423 WP_000489630.1.64242 WP_000489630.1.64244 WP_000489630.1.64266 WP_000489630.1.64293 WP_000489630.1.64332 WP_000489630.1.64350 WP_000489630.1.6437 WP_000489630.1.64374 WP_000489630.1.64376 WP_000489630.1.64385 WP_000489630.1.64387 WP_000489630.1.644 WP_000489630.1.64403 WP_000489630.1.64412 WP_000489630.1.64462 WP_000489630.1.64471 WP_000489630.1.64500 WP_000489630.1.64501 WP_000489630.1.64538 WP_000489630.1.64569 WP_000489630.1.64597 WP_000489630.1.64632 WP_000489630.1.64645 WP_000489630.1.64648 WP_000489630.1.64649 WP_000489630.1.64654 WP_000489630.1.64662 WP_000489630.1.64663 WP_000489630.1.64667 WP_000489630.1.64674 WP_000489630.1.64702 WP_000489630.1.64709 WP_000489630.1.64710 WP_000489630.1.64711 WP_000489630.1.64744 WP_000489630.1.64757 WP_000489630.1.64781 WP_000489630.1.64817 WP_000489630.1.64831 WP_000489630.1.64847 WP_000489630.1.6487 WP_000489630.1.6489 WP_000489630.1.64891 WP_000489630.1.64894 WP_000489630.1.64974 WP_000489630.1.64977 WP_000489630.1.65011 WP_000489630.1.65016 WP_000489630.1.65018 WP_000489630.1.65022 WP_000489630.1.65027 WP_000489630.1.65028 WP_000489630.1.65052 WP_000489630.1.65054 WP_000489630.1.65075 WP_000489630.1.6514 WP_000489630.1.65163 WP_000489630.1.65168 WP_000489630.1.65171 WP_000489630.1.65172 WP_000489630.1.65185 WP_000489630.1.65191 WP_000489630.1.65200 WP_000489630.1.65211 WP_000489630.1.65218 WP_000489630.1.65226 WP_000489630.1.65238 WP_000489630.1.65248 WP_000489630.1.65249 WP_000489630.1.65266 WP_000489630.1.65269 WP_000489630.1.65348 WP_000489630.1.6535 WP_000489630.1.65357 WP_000489630.1.65394 WP_000489630.1.65395 WP_000489630.1.65437 WP_000489630.1.65459 WP_000489630.1.65463 WP_000489630.1.65474 WP_000489630.1.65487 WP_000489630.1.6549 WP_000489630.1.65499 WP_000489630.1.6554 WP_000489630.1.65558 WP_000489630.1.65572 WP_000489630.1.6560 WP_000489630.1.65601 WP_000489630.1.65633 WP_000489630.1.6565 WP_000489630.1.65650 WP_000489630.1.65696 WP_000489630.1.65697 WP_000489630.1.65698 WP_000489630.1.65699 WP_000489630.1.6572 WP_000489630.1.65737 WP_000489630.1.6575 WP_000489630.1.65755 WP_000489630.1.65771 WP_000489630.1.65782 WP_000489630.1.65795 WP_000489630.1.65812 WP_000489630.1.65838 WP_000489630.1.65846 WP_000489630.1.65863 WP_000489630.1.65876 WP_000489630.1.65881 WP_000489630.1.65883 WP_000489630.1.65901 WP_000489630.1.6594 WP_000489630.1.65940 WP_000489630.1.6595 WP_000489630.1.65956 WP_000489630.1.65968 WP_000489630.1.65985 WP_000489630.1.66021 WP_000489630.1.66031 WP_000489630.1.66049 WP_000489630.1.66052 WP_000489630.1.66064 WP_000489630.1.66074 WP_000489630.1.66109 WP_000489630.1.66122 WP_000489630.1.66129 WP_000489630.1.66145 WP_000489630.1.66167 WP_000489630.1.66171 WP_000489630.1.66183 WP_000489630.1.6620 WP_000489630.1.66216 WP_000489630.1.66270 WP_000489630.1.66273 WP_000489630.1.66289 WP_000489630.1.6630 WP_000489630.1.66314 WP_000489630.1.66315 WP_000489630.1.66324 WP_000489630.1.66330 WP_000489630.1.6634 WP_000489630.1.66358 WP_000489630.1.66361 WP_000489630.1.66362 WP_000489630.1.66365 WP_000489630.1.66368 WP_000489630.1.6638 WP_000489630.1.66385 WP_000489630.1.6640 WP_000489630.1.66400 WP_000489630.1.66428 WP_000489630.1.66446 WP_000489630.1.66462 WP_000489630.1.6647 WP_000489630.1.66480 WP_000489630.1.66492 WP_000489630.1.66506 WP_000489630.1.66534 WP_000489630.1.66539 WP_000489630.1.66600 WP_000489630.1.66630 WP_000489630.1.66665 WP_000489630.1.66678 WP_000489630.1.66681 WP_000489630.1.66684 WP_000489630.1.66698 WP_000489630.1.66733 WP_000489630.1.66755 WP_000489630.1.66759 WP_000489630.1.66779 WP_000489630.1.6680 WP_000489630.1.66801 WP_000489630.1.66807 WP_000489630.1.66820 WP_000489630.1.66825 WP_000489630.1.66834 WP_000489630.1.66860 WP_000489630.1.66876 WP_000489630.1.66901 WP_000489630.1.6692 WP_000489630.1.66937 WP_000489630.1.66953 WP_000489630.1.66955 WP_000489630.1.66959 WP_000489630.1.66962 WP_000489630.1.66981 WP_000489630.1.67 WP_000489630.1.67024 WP_000489630.1.67037 WP_000489630.1.67042 WP_000489630.1.67045 WP_000489630.1.67075 WP_000489630.1.6710 WP_000489630.1.67100 WP_000489630.1.67101 WP_000489630.1.67143 WP_000489630.1.67173 WP_000489630.1.67181 WP_000489630.1.67184 WP_000489630.1.67201 WP_000489630.1.67211 WP_000489630.1.67235 WP_000489630.1.67237 WP_000489630.1.67268 WP_000489630.1.67279 WP_000489630.1.67288 WP_000489630.1.67336 WP_000489630.1.67339 WP_000489630.1.67347 WP_000489630.1.67374 WP_000489630.1.67387 WP_000489630.1.6739 WP_000489630.1.67394 WP_000489630.1.67397 WP_000489630.1.67403 WP_000489630.1.67430 WP_000489630.1.67442 WP_000489630.1.67465 WP_000489630.1.67539 WP_000489630.1.67552 WP_000489630.1.67556 WP_000489630.1.67576 WP_000489630.1.6760 WP_000489630.1.67604 WP_000489630.1.67619 WP_000489630.1.67625 WP_000489630.1.67627 WP_000489630.1.67633 WP_000489630.1.67641 WP_000489630.1.67657 WP_000489630.1.67673 WP_000489630.1.67682 WP_000489630.1.67700 WP_000489630.1.67707 WP_000489630.1.67718 WP_000489630.1.67729 WP_000489630.1.67774 WP_000489630.1.67803 WP_000489630.1.6782 WP_000489630.1.67820 WP_000489630.1.67827 WP_000489630.1.67829 WP_000489630.1.67887 WP_000489630.1.67905 WP_000489630.1.67924 WP_000489630.1.67932 WP_000489630.1.67954 WP_000489630.1.67977 WP_000489630.1.68 WP_000489630.1.68036 WP_000489630.1.68043 WP_000489630.1.68073 WP_000489630.1.6809 WP_000489630.1.68105 WP_000489630.1.68113 WP_000489630.1.68115 WP_000489630.1.68131 WP_000489630.1.68140 WP_000489630.1.68159 WP_000489630.1.68182 WP_000489630.1.6819 WP_000489630.1.68201 WP_000489630.1.68206 WP_000489630.1.68210 WP_000489630.1.6827 WP_000489630.1.68275 WP_000489630.1.68285 WP_000489630.1.6833 WP_000489630.1.68359 WP_000489630.1.68401 WP_000489630.1.68420 WP_000489630.1.68477 WP_000489630.1.68478 WP_000489630.1.6849 WP_000489630.1.68514 WP_000489630.1.68532 WP_000489630.1.68547 WP_000489630.1.68564 WP_000489630.1.68589 WP_000489630.1.68591 WP_000489630.1.68652 WP_000489630.1.68655 WP_000489630.1.68656 WP_000489630.1.68677 WP_000489630.1.68688 WP_000489630.1.6869 WP_000489630.1.68690 WP_000489630.1.68742 WP_000489630.1.6875 WP_000489630.1.68778 WP_000489630.1.68787 WP_000489630.1.68809 WP_000489630.1.68816 WP_000489630.1.68818 WP_000489630.1.6882 WP_000489630.1.68893 WP_000489630.1.68894 WP_000489630.1.68895 WP_000489630.1.68914 WP_000489630.1.68928 WP_000489630.1.68958 WP_000489630.1.68975 WP_000489630.1.69001 WP_000489630.1.69006 WP_000489630.1.69011 WP_000489630.1.6904 WP_000489630.1.69053 WP_000489630.1.6907 WP_000489630.1.69080 WP_000489630.1.69086 WP_000489630.1.6913 WP_000489630.1.69131 WP_000489630.1.69146 WP_000489630.1.69151 WP_000489630.1.69170 WP_000489630.1.69210 WP_000489630.1.69236 WP_000489630.1.69255 WP_000489630.1.69270 WP_000489630.1.69273 WP_000489630.1.69282 WP_000489630.1.69288 WP_000489630.1.69296 WP_000489630.1.69320 WP_000489630.1.69346 WP_000489630.1.69357 WP_000489630.1.69359 WP_000489630.1.69371 WP_000489630.1.69376 WP_000489630.1.69396 WP_000489630.1.69397 WP_000489630.1.69465 WP_000489630.1.69466 WP_000489630.1.69485 WP_000489630.1.69515 WP_000489630.1.6954 WP_000489630.1.69564 WP_000489630.1.69575 WP_000489630.1.69597 WP_000489630.1.69611 WP_000489630.1.69616 WP_000489630.1.69636 WP_000489630.1.69642 WP_000489630.1.69644 WP_000489630.1.69656 WP_000489630.1.69657 WP_000489630.1.69690 WP_000489630.1.69696 WP_000489630.1.69704 WP_000489630.1.69710 WP_000489630.1.69754 WP_000489630.1.69758 WP_000489630.1.69760 WP_000489630.1.69767 WP_000489630.1.69785 WP_000489630.1.69790 WP_000489630.1.69807 WP_000489630.1.69808 WP_000489630.1.69848 WP_000489630.1.69890 WP_000489630.1.69923 WP_000489630.1.69948 WP_000489630.1.69953 WP_000489630.1.69975 WP_000489630.1.70010 WP_000489630.1.70047 WP_000489630.1.70049 WP_000489630.1.70058 WP_000489630.1.70061 WP_000489630.1.70088 WP_000489630.1.7014 WP_000489630.1.7016 WP_000489630.1.70205 WP_000489630.1.7021 WP_000489630.1.70240 WP_000489630.1.70241 WP_000489630.1.70248 WP_000489630.1.70249 WP_000489630.1.70261 WP_000489630.1.70269 WP_000489630.1.70272 WP_000489630.1.70289 WP_000489630.1.70303 WP_000489630.1.70314 WP_000489630.1.70321 WP_000489630.1.70326 WP_000489630.1.7033 WP_000489630.1.70427 WP_000489630.1.70433 WP_000489630.1.70440 WP_000489630.1.70447 WP_000489630.1.70485 WP_000489630.1.70491 WP_000489630.1.70523 WP_000489630.1.70531 WP_000489630.1.70545 WP_000489630.1.70547 WP_000489630.1.70596 WP_000489630.1.70623 WP_000489630.1.70643 WP_000489630.1.70671 WP_000489630.1.70678 WP_000489630.1.70679 WP_000489630.1.70683 WP_000489630.1.70708 WP_000489630.1.70717 WP_000489630.1.70731 WP_000489630.1.70732 WP_000489630.1.70772 WP_000489630.1.70785 WP_000489630.1.70797 WP_000489630.1.70837 WP_000489630.1.70845 WP_000489630.1.70846 WP_000489630.1.70869 WP_000489630.1.70883 WP_000489630.1.70914 WP_000489630.1.70922 WP_000489630.1.70929 WP_000489630.1.70948 WP_000489630.1.70959 WP_000489630.1.70969 WP_000489630.1.70977 WP_000489630.1.70981 WP_000489630.1.70985 WP_000489630.1.70995 WP_000489630.1.71007 WP_000489630.1.71023 WP_000489630.1.71039 WP_000489630.1.71057 WP_000489630.1.71069 WP_000489630.1.71081 WP_000489630.1.7110 WP_000489630.1.71116 WP_000489630.1.71117 WP_000489630.1.71120 WP_000489630.1.71146 WP_000489630.1.71165 WP_000489630.1.71172 WP_000489630.1.71184 WP_000489630.1.71186 WP_000489630.1.71188 WP_000489630.1.71201 WP_000489630.1.71202 WP_000489630.1.71243 WP_000489630.1.71248 WP_000489630.1.71268 WP_000489630.1.71299 WP_000489630.1.71305 WP_000489630.1.71306 WP_000489630.1.71337 WP_000489630.1.71363 WP_000489630.1.71368 WP_000489630.1.71378 WP_000489630.1.71401 WP_000489630.1.71446 WP_000489630.1.71452 WP_000489630.1.71455 WP_000489630.1.71456 WP_000489630.1.71481 WP_000489630.1.71487 WP_000489630.1.71500 WP_000489630.1.71523 WP_000489630.1.71542 WP_000489630.1.71566 WP_000489630.1.71600 WP_000489630.1.71626 WP_000489630.1.71636 WP_000489630.1.71649 WP_000489630.1.71651 WP_000489630.1.71653 WP_000489630.1.71691 WP_000489630.1.71702 WP_000489630.1.71716 WP_000489630.1.7174 WP_000489630.1.71750 WP_000489630.1.71756 WP_000489630.1.71798 WP_000489630.1.71845 WP_000489630.1.71872 WP_000489630.1.71881 WP_000489630.1.71908 WP_000489630.1.71923 WP_000489630.1.71929 WP_000489630.1.71950 WP_000489630.1.71952 WP_000489630.1.71954 WP_000489630.1.71973 WP_000489630.1.71979 WP_000489630.1.71984 WP_000489630.1.71985 WP_000489630.1.720 WP_000489630.1.72003 WP_000489630.1.72065 WP_000489630.1.72068 WP_000489630.1.72073 WP_000489630.1.72100 WP_000489630.1.72105 WP_000489630.1.72107 WP_000489630.1.72182 WP_000489630.1.72188 WP_000489630.1.72190 WP_000489630.1.72203 WP_000489630.1.72220 WP_000489630.1.72221 WP_000489630.1.72226 WP_000489630.1.72269 WP_000489630.1.72281 WP_000489630.1.72283 WP_000489630.1.72300 WP_000489630.1.72325 WP_000489630.1.72339 WP_000489630.1.72350 WP_000489630.1.72351 WP_000489630.1.72372 WP_000489630.1.72376 WP_000489630.1.72382 WP_000489630.1.72383 WP_000489630.1.72403 WP_000489630.1.72412 WP_000489630.1.7243 WP_000489630.1.72461 WP_000489630.1.72470 WP_000489630.1.72527 WP_000489630.1.72532 WP_000489630.1.7255 WP_000489630.1.72594 WP_000489630.1.72602 WP_000489630.1.72625 WP_000489630.1.72631 WP_000489630.1.72638 WP_000489630.1.72642 WP_000489630.1.72667 WP_000489630.1.72674 WP_000489630.1.72689 WP_000489630.1.72716 WP_000489630.1.72718 WP_000489630.1.72724 WP_000489630.1.72789 WP_000489630.1.72827 WP_000489630.1.72828 WP_000489630.1.72850 WP_000489630.1.72865 WP_000489630.1.72871 WP_000489630.1.72887 WP_000489630.1.72896 WP_000489630.1.72944 WP_000489630.1.7295 WP_000489630.1.72968 WP_000489630.1.72969 WP_000489630.1.72975 WP_000489630.1.72987 WP_000489630.1.7304 WP_000489630.1.73052 WP_000489630.1.73062 WP_000489630.1.73068 WP_000489630.1.7311 WP_000489630.1.73114 WP_000489630.1.73125 WP_000489630.1.73144 WP_000489630.1.7315 WP_000489630.1.73177 WP_000489630.1.73180 WP_000489630.1.73200 WP_000489630.1.73258 WP_000489630.1.73270 WP_000489630.1.73285 WP_000489630.1.7332 WP_000489630.1.73328 WP_000489630.1.7333 WP_000489630.1.7334 WP_000489630.1.73352 WP_000489630.1.73362 WP_000489630.1.73377 WP_000489630.1.73379 WP_000489630.1.73389 WP_000489630.1.73425 WP_000489630.1.73461 WP_000489630.1.73481 WP_000489630.1.73488 WP_000489630.1.73504 WP_000489630.1.7353 WP_000489630.1.73535 WP_000489630.1.73544 WP_000489630.1.7356 WP_000489630.1.73561 WP_000489630.1.73581 WP_000489630.1.73596 WP_000489630.1.73598 WP_000489630.1.73617 WP_000489630.1.73648 WP_000489630.1.73667 WP_000489630.1.73669 WP_000489630.1.73708 WP_000489630.1.73753 WP_000489630.1.73758 WP_000489630.1.73764 WP_000489630.1.73768 WP_000489630.1.73794 WP_000489630.1.73831 WP_000489630.1.73847 WP_000489630.1.73849 WP_000489630.1.7387 WP_000489630.1.73901 WP_000489630.1.73924 WP_000489630.1.73926 WP_000489630.1.73945 WP_000489630.1.73948 WP_000489630.1.73956 WP_000489630.1.73999 WP_000489630.1.74024 WP_000489630.1.74029 WP_000489630.1.74030 WP_000489630.1.74038 WP_000489630.1.74043 WP_000489630.1.74049 WP_000489630.1.74058 WP_000489630.1.74070 WP_000489630.1.74077 WP_000489630.1.74117 WP_000489630.1.74135 WP_000489630.1.74174 WP_000489630.1.74181 WP_000489630.1.74191 WP_000489630.1.74207 WP_000489630.1.74214 WP_000489630.1.74241 WP_000489630.1.74248 WP_000489630.1.74285 WP_000489630.1.743 WP_000489630.1.7430 WP_000489630.1.74300 WP_000489630.1.74317 WP_000489630.1.7433 WP_000489630.1.74379 WP_000489630.1.74402 WP_000489630.1.74410 WP_000489630.1.74415 WP_000489630.1.74422 WP_000489630.1.7444 WP_000489630.1.74466 WP_000489630.1.745 WP_000489630.1.74529 WP_000489630.1.74545 WP_000489630.1.74578 WP_000489630.1.74616 WP_000489630.1.74621 WP_000489630.1.74639 WP_000489630.1.74644 WP_000489630.1.74647 WP_000489630.1.74661 WP_000489630.1.74699 WP_000489630.1.74702 WP_000489630.1.74745 WP_000489630.1.74826 WP_000489630.1.74831 WP_000489630.1.74884 WP_000489630.1.74894 WP_000489630.1.7491 WP_000489630.1.74929 WP_000489630.1.74939 WP_000489630.1.74946 WP_000489630.1.74972 WP_000489630.1.74973 WP_000489630.1.74992 WP_000489630.1.74996 WP_000489630.1.75009 WP_000489630.1.75051 WP_000489630.1.7507 WP_000489630.1.75089 WP_000489630.1.75116 WP_000489630.1.75129 WP_000489630.1.75148 WP_000489630.1.75159 WP_000489630.1.75177 WP_000489630.1.75180 WP_000489630.1.75187 WP_000489630.1.75237 WP_000489630.1.75273 WP_000489630.1.75288 WP_000489630.1.75296 WP_000489630.1.75334 WP_000489630.1.75385 WP_000489630.1.75392 WP_000489630.1.75400 WP_000489630.1.75402 WP_000489630.1.75413 WP_000489630.1.7543 WP_000489630.1.75433 WP_000489630.1.75450 WP_000489630.1.75494 WP_000489630.1.75532 WP_000489630.1.75565 WP_000489630.1.7558 WP_000489630.1.75585 WP_000489630.1.75593 WP_000489630.1.75607 WP_000489630.1.75609 WP_000489630.1.75610 WP_000489630.1.75626 WP_000489630.1.75633 WP_000489630.1.75664 WP_000489630.1.75703 WP_000489630.1.75716 WP_000489630.1.75718 WP_000489630.1.75745 WP_000489630.1.75751 WP_000489630.1.75760 WP_000489630.1.75764 WP_000489630.1.75793 WP_000489630.1.75794 WP_000489630.1.75810 WP_000489630.1.75828 WP_000489630.1.75837 WP_000489630.1.75844 WP_000489630.1.75863 WP_000489630.1.75873 WP_000489630.1.75874 WP_000489630.1.75884 WP_000489630.1.75886 WP_000489630.1.75898 WP_000489630.1.75902 WP_000489630.1.75932 WP_000489630.1.75945 WP_000489630.1.75957 WP_000489630.1.76 WP_000489630.1.76020 WP_000489630.1.76024 WP_000489630.1.76081 WP_000489630.1.76097 WP_000489630.1.76102 WP_000489630.1.76108 WP_000489630.1.76116 WP_000489630.1.76122 WP_000489630.1.76137 WP_000489630.1.76164 WP_000489630.1.76170 WP_000489630.1.76186 WP_000489630.1.76208 WP_000489630.1.76252 WP_000489630.1.7629 WP_000489630.1.76301 WP_000489630.1.76327 WP_000489630.1.76339 WP_000489630.1.7634 WP_000489630.1.76345 WP_000489630.1.76364 WP_000489630.1.76366 WP_000489630.1.76417 WP_000489630.1.76434 WP_000489630.1.76445 WP_000489630.1.76451 WP_000489630.1.7646 WP_000489630.1.76495 WP_000489630.1.76510 WP_000489630.1.76532 WP_000489630.1.76548 WP_000489630.1.76558 WP_000489630.1.76572 WP_000489630.1.76576 WP_000489630.1.7660 WP_000489630.1.76641 WP_000489630.1.76651 WP_000489630.1.76653 WP_000489630.1.76673 WP_000489630.1.76706 WP_000489630.1.76721 WP_000489630.1.76724 WP_000489630.1.76738 WP_000489630.1.76756 WP_000489630.1.76760 WP_000489630.1.76776 WP_000489630.1.76788 WP_000489630.1.76806 WP_000489630.1.76854 WP_000489630.1.76875 WP_000489630.1.76880 WP_000489630.1.76899 WP_000489630.1.76913 WP_000489630.1.76916 WP_000489630.1.76932 WP_000489630.1.76968 WP_000489630.1.76973 WP_000489630.1.76988 WP_000489630.1.77016 WP_000489630.1.77038 WP_000489630.1.77047 WP_000489630.1.77067 WP_000489630.1.77080 WP_000489630.1.77087 WP_000489630.1.77090 WP_000489630.1.77111 WP_000489630.1.7712 WP_000489630.1.77177 WP_000489630.1.77180 WP_000489630.1.77184 WP_000489630.1.77193 WP_000489630.1.77244 WP_000489630.1.77267 WP_000489630.1.77271 WP_000489630.1.77292 WP_000489630.1.77299 WP_000489630.1.77306 WP_000489630.1.77313 WP_000489630.1.77349 WP_000489630.1.77356 WP_000489630.1.77384 WP_000489630.1.77390 WP_000489630.1.77431 WP_000489630.1.77436 WP_000489630.1.77440 WP_000489630.1.77475 WP_000489630.1.77496 WP_000489630.1.77501 WP_000489630.1.77512 WP_000489630.1.77513 WP_000489630.1.77514 WP_000489630.1.77529 WP_000489630.1.77543 WP_000489630.1.77549 WP_000489630.1.77555 WP_000489630.1.77563 WP_000489630.1.77565 WP_000489630.1.77575 WP_000489630.1.77629 WP_000489630.1.77646 WP_000489630.1.77653 WP_000489630.1.77692 WP_000489630.1.77702 WP_000489630.1.77710 WP_000489630.1.77713 WP_000489630.1.7772 WP_000489630.1.77729 WP_000489630.1.77754 WP_000489630.1.7782 WP_000489630.1.77825 WP_000489630.1.77837 WP_000489630.1.77846 WP_000489630.1.77851 WP_000489630.1.77898 WP_000489630.1.77900 WP_000489630.1.77918 WP_000489630.1.7792 WP_000489630.1.77923 WP_000489630.1.7793 WP_000489630.1.77951 WP_000489630.1.77960 WP_000489630.1.77975 WP_000489630.1.77983 WP_000489630.1.77987 WP_000489630.1.77989 WP_000489630.1.7802 WP_000489630.1.78033 WP_000489630.1.78035 WP_000489630.1.78048 WP_000489630.1.78051 WP_000489630.1.78053 WP_000489630.1.78076 WP_000489630.1.78096 WP_000489630.1.78100 WP_000489630.1.78107 WP_000489630.1.78110 WP_000489630.1.78120 WP_000489630.1.78166 WP_000489630.1.78170 WP_000489630.1.78195 WP_000489630.1.78201 WP_000489630.1.78245 WP_000489630.1.78291 WP_000489630.1.78301 WP_000489630.1.78309 WP_000489630.1.78320 WP_000489630.1.78372 WP_000489630.1.78382 WP_000489630.1.78383 WP_000489630.1.78388 WP_000489630.1.78407 WP_000489630.1.78410 WP_000489630.1.78443 WP_000489630.1.78495 WP_000489630.1.78496 WP_000489630.1.78501 WP_000489630.1.78602 WP_000489630.1.7861 WP_000489630.1.78618 WP_000489630.1.7862 WP_000489630.1.78626 WP_000489630.1.78632 WP_000489630.1.78658 WP_000489630.1.78661 WP_000489630.1.78673 WP_000489630.1.78674 WP_000489630.1.78676 WP_000489630.1.78697 WP_000489630.1.78734 WP_000489630.1.78735 WP_000489630.1.78738 WP_000489630.1.78761 WP_000489630.1.7877 WP_000489630.1.78802 WP_000489630.1.78815 WP_000489630.1.78830 WP_000489630.1.78835 WP_000489630.1.78838 WP_000489630.1.78862 WP_000489630.1.78871 WP_000489630.1.78874 WP_000489630.1.78877 WP_000489630.1.78896 WP_000489630.1.789 WP_000489630.1.7891 WP_000489630.1.78918 WP_000489630.1.78928 WP_000489630.1.78930 WP_000489630.1.78993 WP_000489630.1.79012 WP_000489630.1.79032 WP_000489630.1.79069 WP_000489630.1.79074 WP_000489630.1.79081 WP_000489630.1.79098 WP_000489630.1.79099 WP_000489630.1.79151 WP_000489630.1.79155 WP_000489630.1.79164 WP_000489630.1.79167 WP_000489630.1.79203 WP_000489630.1.79204 WP_000489630.1.79235 WP_000489630.1.79280 WP_000489630.1.79289 WP_000489630.1.79302 WP_000489630.1.79335 WP_000489630.1.79370 WP_000489630.1.79397 WP_000489630.1.79456 WP_000489630.1.79462 WP_000489630.1.79468 WP_000489630.1.79472 WP_000489630.1.79490 WP_000489630.1.79495 WP_000489630.1.79529 WP_000489630.1.79532 WP_000489630.1.79547 WP_000489630.1.79570 WP_000489630.1.79580 WP_000489630.1.79586 WP_000489630.1.7964 WP_000489630.1.79642 WP_000489630.1.79654 WP_000489630.1.79659 WP_000489630.1.79668 WP_000489630.1.7970 WP_000489630.1.79708 WP_000489630.1.7972 WP_000489630.1.79722 WP_000489630.1.79734 WP_000489630.1.79757 WP_000489630.1.79772 WP_000489630.1.7979 WP_000489630.1.7982 WP_000489630.1.79832 WP_000489630.1.79845 WP_000489630.1.79867 WP_000489630.1.79880 WP_000489630.1.79892 WP_000489630.1.79910 WP_000489630.1.79914 WP_000489630.1.79916 WP_000489630.1.79929 WP_000489630.1.79951 WP_000489630.1.79966 WP_000489630.1.80065 WP_000489630.1.80077 WP_000489630.1.80103 WP_000489630.1.80137 WP_000489630.1.80182 WP_000489630.1.80249 WP_000489630.1.80250 WP_000489630.1.80254 WP_000489630.1.80273 WP_000489630.1.80282 WP_000489630.1.80293 WP_000489630.1.80296 WP_000489630.1.80354 WP_000489630.1.80366 WP_000489630.1.80368 WP_000489630.1.80380 WP_000489630.1.80386 WP_000489630.1.80400 WP_000489630.1.80441 WP_000489630.1.80443 WP_000489630.1.80462 WP_000489630.1.80479 WP_000489630.1.80480 WP_000489630.1.8049 WP_000489630.1.80492 WP_000489630.1.80529 WP_000489630.1.80542 WP_000489630.1.80569 WP_000489630.1.80586 WP_000489630.1.80609 WP_000489630.1.80629 WP_000489630.1.80638 WP_000489630.1.80651 WP_000489630.1.80664 WP_000489630.1.80667 WP_000489630.1.80674 WP_000489630.1.80696 WP_000489630.1.80725 WP_000489630.1.80741 WP_000489630.1.80760 WP_000489630.1.80780 WP_000489630.1.80819 WP_000489630.1.80827 WP_000489630.1.80831 WP_000489630.1.80850 WP_000489630.1.80857 WP_000489630.1.80874 WP_000489630.1.80876 WP_000489630.1.80881 WP_000489630.1.80913 WP_000489630.1.80939 WP_000489630.1.8096 WP_000489630.1.80984 WP_000489630.1.81037 WP_000489630.1.8106 WP_000489630.1.81069 WP_000489630.1.81110 WP_000489630.1.81131 WP_000489630.1.81149 WP_000489630.1.81175 WP_000489630.1.81187 WP_000489630.1.8119 WP_000489630.1.81193 WP_000489630.1.81197 WP_000489630.1.81225 WP_000489630.1.81231 WP_000489630.1.81262 WP_000489630.1.81268 WP_000489630.1.81269 WP_000489630.1.81271 WP_000489630.1.81275 WP_000489630.1.8130 WP_000489630.1.81302 WP_000489630.1.81305 WP_000489630.1.8131 WP_000489630.1.81321 WP_000489630.1.81328 WP_000489630.1.81333 WP_000489630.1.8134 WP_000489630.1.81342 WP_000489630.1.81364 WP_000489630.1.81388 WP_000489630.1.81410 WP_000489630.1.81425 WP_000489630.1.81455 WP_000489630.1.81472 WP_000489630.1.81494 WP_000489630.1.81504 WP_000489630.1.81528 WP_000489630.1.81557 WP_000489630.1.81667 WP_000489630.1.81668 WP_000489630.1.81676 WP_000489630.1.8168 WP_000489630.1.8170 WP_000489630.1.81727 WP_000489630.1.81735 WP_000489630.1.81746 WP_000489630.1.81750 WP_000489630.1.81760 WP_000489630.1.81763 WP_000489630.1.81768 WP_000489630.1.81785 WP_000489630.1.81795 WP_000489630.1.81855 WP_000489630.1.81902 WP_000489630.1.81921 WP_000489630.1.81931 WP_000489630.1.81936 WP_000489630.1.81949 WP_000489630.1.81965 WP_000489630.1.81974 WP_000489630.1.81995 WP_000489630.1.82037 WP_000489630.1.82070 WP_000489630.1.82076 WP_000489630.1.82099 WP_000489630.1.82131 WP_000489630.1.82149 WP_000489630.1.82156 WP_000489630.1.8218 WP_000489630.1.82180 WP_000489630.1.82192 WP_000489630.1.82201 WP_000489630.1.82225 WP_000489630.1.82232 WP_000489630.1.82258 WP_000489630.1.82269 WP_000489630.1.82337 WP_000489630.1.8236 WP_000489630.1.82369 WP_000489630.1.82395 WP_000489630.1.8240 WP_000489630.1.82401 WP_000489630.1.82416 WP_000489630.1.8242 WP_000489630.1.82420 WP_000489630.1.82434 WP_000489630.1.82456 WP_000489630.1.82464 WP_000489630.1.82465 WP_000489630.1.8247 WP_000489630.1.82473 WP_000489630.1.82474 WP_000489630.1.82479 WP_000489630.1.82503 WP_000489630.1.82515 WP_000489630.1.82530 WP_000489630.1.82553 WP_000489630.1.82569 WP_000489630.1.82570 WP_000489630.1.82584 WP_000489630.1.82646 WP_000489630.1.82648 WP_000489630.1.82670 WP_000489630.1.82676 WP_000489630.1.82731 WP_000489630.1.82761 WP_000489630.1.82763 WP_000489630.1.82812 WP_000489630.1.8282 WP_000489630.1.82841 WP_000489630.1.82843 WP_000489630.1.82850 WP_000489630.1.82867 WP_000489630.1.82872 WP_000489630.1.82886 WP_000489630.1.82895 WP_000489630.1.82908 WP_000489630.1.82937 WP_000489630.1.8294 WP_000489630.1.82944 WP_000489630.1.82946 WP_000489630.1.82956 WP_000489630.1.82959 WP_000489630.1.82992 WP_000489630.1.83005 WP_000489630.1.83006 WP_000489630.1.83007 WP_000489630.1.8304 WP_000489630.1.83061 WP_000489630.1.83092 WP_000489630.1.83119 WP_000489630.1.83139 WP_000489630.1.83163 WP_000489630.1.83180 WP_000489630.1.83204 WP_000489630.1.8322 WP_000489630.1.83221 WP_000489630.1.83229 WP_000489630.1.83235 WP_000489630.1.83290 WP_000489630.1.83301 WP_000489630.1.83305 WP_000489630.1.83331 WP_000489630.1.83333 WP_000489630.1.83354 WP_000489630.1.83356 WP_000489630.1.83360 WP_000489630.1.83365 WP_000489630.1.83378 WP_000489630.1.83382 WP_000489630.1.83407 WP_000489630.1.83413 WP_000489630.1.83491 WP_000489630.1.83510 WP_000489630.1.83516 WP_000489630.1.83523 WP_000489630.1.8354 WP_000489630.1.83558 WP_000489630.1.83598 WP_000489630.1.83650 WP_000489630.1.83651 WP_000489630.1.83657 WP_000489630.1.83677 WP_000489630.1.83710 WP_000489630.1.83721 WP_000489630.1.83739 WP_000489630.1.8375 WP_000489630.1.83759 WP_000489630.1.83760 WP_000489630.1.83854 WP_000489630.1.83897 WP_000489630.1.83923 WP_000489630.1.83960 WP_000489630.1.83979 WP_000489630.1.8399 WP_000489630.1.83994 WP_000489630.1.83995 WP_000489630.1.84 WP_000489630.1.84000 WP_000489630.1.84001 WP_000489630.1.84011 WP_000489630.1.84031 WP_000489630.1.8406 WP_000489630.1.84075 WP_000489630.1.84076 WP_000489630.1.84077 WP_000489630.1.84083 WP_000489630.1.84086 WP_000489630.1.84100 WP_000489630.1.84103 WP_000489630.1.84110 WP_000489630.1.84127 WP_000489630.1.84150 WP_000489630.1.84154 WP_000489630.1.84168 WP_000489630.1.84179 WP_000489630.1.84230 WP_000489630.1.8425 WP_000489630.1.84252 WP_000489630.1.84283 WP_000489630.1.84291 WP_000489630.1.84300 WP_000489630.1.8431 WP_000489630.1.84345 WP_000489630.1.84355 WP_000489630.1.84359 WP_000489630.1.84369 WP_000489630.1.84392 WP_000489630.1.84397 WP_000489630.1.84401 WP_000489630.1.8441 WP_000489630.1.84435 WP_000489630.1.84461 WP_000489630.1.84497 WP_000489630.1.84515 WP_000489630.1.84532 WP_000489630.1.84551 WP_000489630.1.84554 WP_000489630.1.84567 WP_000489630.1.84572 WP_000489630.1.84598 WP_000489630.1.84631 WP_000489630.1.84659 WP_000489630.1.84683 WP_000489630.1.84693 WP_000489630.1.84711 WP_000489630.1.84727 WP_000489630.1.84744 WP_000489630.1.84773 WP_000489630.1.84876 WP_000489630.1.84899 WP_000489630.1.849 WP_000489630.1.84945 WP_000489630.1.84967 WP_000489630.1.8497 WP_000489630.1.84983 WP_000489630.1.85004 WP_000489630.1.85014 WP_000489630.1.8502 WP_000489630.1.85039 WP_000489630.1.85040 WP_000489630.1.85079 WP_000489630.1.85094 WP_000489630.1.85120 WP_000489630.1.85126 WP_000489630.1.85134 WP_000489630.1.85147 WP_000489630.1.85153 WP_000489630.1.85178 WP_000489630.1.85180 WP_000489630.1.85190 WP_000489630.1.8526 WP_000489630.1.85271 WP_000489630.1.85273 WP_000489630.1.85301 WP_000489630.1.8533 WP_000489630.1.85338 WP_000489630.1.85339 WP_000489630.1.85433 WP_000489630.1.8545 WP_000489630.1.85469 WP_000489630.1.85481 WP_000489630.1.85483 WP_000489630.1.85511 WP_000489630.1.85512 WP_000489630.1.8552 WP_000489630.1.85541 WP_000489630.1.8556 WP_000489630.1.85568 WP_000489630.1.8557 WP_000489630.1.85606 WP_000489630.1.85615 WP_000489630.1.85617 WP_000489630.1.85635 WP_000489630.1.85646 WP_000489630.1.85663 WP_000489630.1.85665 WP_000489630.1.85669 WP_000489630.1.85671 WP_000489630.1.85672 WP_000489630.1.85675 WP_000489630.1.85688 WP_000489630.1.85703 WP_000489630.1.85723 WP_000489630.1.85728 WP_000489630.1.85742 WP_000489630.1.85746 WP_000489630.1.85759 WP_000489630.1.85777 WP_000489630.1.85811 WP_000489630.1.85855 WP_000489630.1.85886 WP_000489630.1.859 WP_000489630.1.85900 WP_000489630.1.85904 WP_000489630.1.8591 WP_000489630.1.85917 WP_000489630.1.8594 WP_000489630.1.85943 WP_000489630.1.85976 WP_000489630.1.85977 WP_000489630.1.85982 WP_000489630.1.860 WP_000489630.1.86007 WP_000489630.1.86010 WP_000489630.1.86017 WP_000489630.1.8605 WP_000489630.1.86084 WP_000489630.1.8610 WP_000489630.1.8614 WP_000489630.1.86156 WP_000489630.1.86157 WP_000489630.1.86159 WP_000489630.1.8616 WP_000489630.1.86173 WP_000489630.1.86240 WP_000489630.1.86285 WP_000489630.1.86306 WP_000489630.1.86310 WP_000489630.1.86316 WP_000489630.1.86323 WP_000489630.1.86335 WP_000489630.1.86342 WP_000489630.1.86347 WP_000489630.1.86356 WP_000489630.1.86380 WP_000489630.1.86389 WP_000489630.1.8640 WP_000489630.1.8642 WP_000489630.1.86450 WP_000489630.1.86453 WP_000489630.1.86469 WP_000489630.1.8647 WP_000489630.1.86489 WP_000489630.1.86514 WP_000489630.1.86530 WP_000489630.1.86580 WP_000489630.1.86588 WP_000489630.1.86601 WP_000489630.1.86610 WP_000489630.1.86634 WP_000489630.1.86661 WP_000489630.1.86663 WP_000489630.1.86699 WP_000489630.1.8671 WP_000489630.1.8672 WP_000489630.1.86744 WP_000489630.1.86770 WP_000489630.1.8678 WP_000489630.1.86794 WP_000489630.1.86800 WP_000489630.1.86807 WP_000489630.1.86810 WP_000489630.1.86811 WP_000489630.1.8684 WP_000489630.1.86859 WP_000489630.1.86860 WP_000489630.1.86895 WP_000489630.1.86902 WP_000489630.1.86906 WP_000489630.1.86915 WP_000489630.1.86945 WP_000489630.1.86982 WP_000489630.1.86989 WP_000489630.1.87023 WP_000489630.1.87034 WP_000489630.1.87038 WP_000489630.1.87041 WP_000489630.1.87051 WP_000489630.1.87095 WP_000489630.1.87136 WP_000489630.1.87143 WP_000489630.1.87155 WP_000489630.1.87187 WP_000489630.1.8722 WP_000489630.1.87258 WP_000489630.1.87265 WP_000489630.1.87283 WP_000489630.1.87293 WP_000489630.1.87323 WP_000489630.1.87346 WP_000489630.1.8736 WP_000489630.1.87370 WP_000489630.1.87420 WP_000489630.1.87460 WP_000489630.1.87484 WP_000489630.1.87493 WP_000489630.1.87500 WP_000489630.1.87528 WP_000489630.1.87552 WP_000489630.1.87560 WP_000489630.1.87583 WP_000489630.1.87584 WP_000489630.1.8760 WP_000489630.1.87600 WP_000489630.1.87609 WP_000489630.1.87612 WP_000489630.1.87615 WP_000489630.1.87653 WP_000489630.1.8767 WP_000489630.1.87695 WP_000489630.1.87698 WP_000489630.1.87706 WP_000489630.1.87712 WP_000489630.1.87739 WP_000489630.1.87741 WP_000489630.1.87742 WP_000489630.1.87760 WP_000489630.1.87779 WP_000489630.1.87852 WP_000489630.1.87875 WP_000489630.1.87899 WP_000489630.1.87936 WP_000489630.1.87945 WP_000489630.1.87949 WP_000489630.1.88014 WP_000489630.1.88019 WP_000489630.1.88025 WP_000489630.1.88026 WP_000489630.1.8805 WP_000489630.1.88052 WP_000489630.1.8806 WP_000489630.1.88073 WP_000489630.1.8809 WP_000489630.1.881 WP_000489630.1.88145 WP_000489630.1.88174 WP_000489630.1.88185 WP_000489630.1.88199 WP_000489630.1.88222 WP_000489630.1.88244 WP_000489630.1.88275 WP_000489630.1.88291 WP_000489630.1.88293 WP_000489630.1.88299 WP_000489630.1.88303 WP_000489630.1.88313 WP_000489630.1.88356 WP_000489630.1.88359 WP_000489630.1.8837 WP_000489630.1.88393 WP_000489630.1.88407 WP_000489630.1.88414 WP_000489630.1.88423 WP_000489630.1.88444 WP_000489630.1.88446 WP_000489630.1.88458 WP_000489630.1.88474 WP_000489630.1.88501 WP_000489630.1.88508 WP_000489630.1.88547 WP_000489630.1.886 WP_000489630.1.88609 WP_000489630.1.88620 WP_000489630.1.88624 WP_000489630.1.88647 WP_000489630.1.88648 WP_000489630.1.88692 WP_000489630.1.88698 WP_000489630.1.88703 WP_000489630.1.88707 WP_000489630.1.88727 WP_000489630.1.88731 WP_000489630.1.88762 WP_000489630.1.88772 WP_000489630.1.88792 WP_000489630.1.88845 WP_000489630.1.88850 WP_000489630.1.8889 WP_000489630.1.88894 WP_000489630.1.88902 WP_000489630.1.8891 WP_000489630.1.88942 WP_000489630.1.88957 WP_000489630.1.88966 WP_000489630.1.88967 WP_000489630.1.88968 WP_000489630.1.88980 WP_000489630.1.88981 WP_000489630.1.88982 WP_000489630.1.88995 WP_000489630.1.88998 WP_000489630.1.89008 WP_000489630.1.89054 WP_000489630.1.89114 WP_000489630.1.89116 WP_000489630.1.89119 WP_000489630.1.89120 WP_000489630.1.89138 WP_000489630.1.89177 WP_000489630.1.89182 WP_000489630.1.89188 WP_000489630.1.89215 WP_000489630.1.89221 WP_000489630.1.89298 WP_000489630.1.89304 WP_000489630.1.89308 WP_000489630.1.89314 WP_000489630.1.89328 WP_000489630.1.89332 WP_000489630.1.89343 WP_000489630.1.89354 WP_000489630.1.89362 WP_000489630.1.89395 WP_000489630.1.8940 WP_000489630.1.89408 WP_000489630.1.89425 WP_000489630.1.89449 WP_000489630.1.89452 WP_000489630.1.8947 WP_000489630.1.89503 WP_000489630.1.89512 WP_000489630.1.89527 WP_000489630.1.89570 WP_000489630.1.8958 WP_000489630.1.89591 WP_000489630.1.89604 WP_000489630.1.89606 WP_000489630.1.8961 WP_000489630.1.89612 WP_000489630.1.89622 WP_000489630.1.89632 WP_000489630.1.89634 WP_000489630.1.89659 WP_000489630.1.89668 WP_000489630.1.89680 WP_000489630.1.89706 WP_000489630.1.89713 WP_000489630.1.89733 WP_000489630.1.89765 WP_000489630.1.89777 WP_000489630.1.89796 WP_000489630.1.89804 WP_000489630.1.89815 WP_000489630.1.89817 WP_000489630.1.89832 WP_000489630.1.89845 WP_000489630.1.89888 WP_000489630.1.89902 WP_000489630.1.89911 WP_000489630.1.8995 WP_000489630.1.89952 WP_000489630.1.8996 WP_000489630.1.89965 WP_000489630.1.89975 WP_000489630.1.90007 WP_000489630.1.9003 WP_000489630.1.90033 WP_000489630.1.90084 WP_000489630.1.90097 WP_000489630.1.90108 WP_000489630.1.9011 WP_000489630.1.90196 WP_000489630.1.90211 WP_000489630.1.90240 WP_000489630.1.90248 WP_000489630.1.90252 WP_000489630.1.90274 WP_000489630.1.90280 WP_000489630.1.90330 WP_000489630.1.90338 WP_000489630.1.90348 WP_000489630.1.90363 WP_000489630.1.90365 WP_000489630.1.90409 WP_000489630.1.90417 WP_000489630.1.90421 WP_000489630.1.90428 WP_000489630.1.90440 WP_000489630.1.90453 WP_000489630.1.90458 WP_000489630.1.90472 WP_000489630.1.90489 WP_000489630.1.90513 WP_000489630.1.90522 WP_000489630.1.90540 WP_000489630.1.90557 WP_000489630.1.90563 WP_000489630.1.90582 WP_000489630.1.90585 WP_000489630.1.90620 WP_000489630.1.90625 WP_000489630.1.9064 WP_000489630.1.90641 WP_000489630.1.90701 WP_000489630.1.90713 WP_000489630.1.90734 WP_000489630.1.90748 WP_000489630.1.90759 WP_000489630.1.90792 WP_000489630.1.90794 WP_000489630.1.90796 WP_000489630.1.90811 WP_000489630.1.90866 WP_000489630.1.90876 WP_000489630.1.9091 WP_000489630.1.90959 WP_000489630.1.90973 WP_000489630.1.90983 WP_000489630.1.90984 WP_000489630.1.91003 WP_000489630.1.91049 WP_000489630.1.91056 WP_000489630.1.91067 WP_000489630.1.91069 WP_000489630.1.91107 WP_000489630.1.91164 WP_000489630.1.91179 WP_000489630.1.91205 WP_000489630.1.91215 WP_000489630.1.91239 WP_000489630.1.91278 WP_000489630.1.91291 WP_000489630.1.9131 WP_000489630.1.91313 WP_000489630.1.9135 WP_000489630.1.9137 WP_000489630.1.91372 WP_000489630.1.91424 WP_000489630.1.91453 WP_000489630.1.91459 WP_000489630.1.91470 WP_000489630.1.91474 WP_000489630.1.91493 WP_000489630.1.91505 WP_000489630.1.91506 WP_000489630.1.91512 WP_000489630.1.91524 WP_000489630.1.91528 WP_000489630.1.91557 WP_000489630.1.91564 WP_000489630.1.91579 WP_000489630.1.91597 WP_000489630.1.91621 WP_000489630.1.91625 WP_000489630.1.91628 WP_000489630.1.91655 WP_000489630.1.91715 WP_000489630.1.91724 WP_000489630.1.91732 WP_000489630.1.91736 WP_000489630.1.91742 WP_000489630.1.91772 WP_000489630.1.91776 WP_000489630.1.91788 WP_000489630.1.91795 WP_000489630.1.91806 WP_000489630.1.9187 WP_000489630.1.91870 WP_000489630.1.91898 WP_000489630.1.91903 WP_000489630.1.91904 WP_000489630.1.91974 WP_000489630.1.92013 WP_000489630.1.92018 WP_000489630.1.92044 WP_000489630.1.92047 WP_000489630.1.92060 WP_000489630.1.92067 WP_000489630.1.92082 WP_000489630.1.92087 WP_000489630.1.92093 WP_000489630.1.92098 WP_000489630.1.92108 WP_000489630.1.92129 WP_000489630.1.92156 WP_000489630.1.92165 WP_000489630.1.92171 WP_000489630.1.92172 WP_000489630.1.92183 WP_000489630.1.92208 WP_000489630.1.92213 WP_000489630.1.9222 WP_000489630.1.92240 WP_000489630.1.92243 WP_000489630.1.92268 WP_000489630.1.92299 WP_000489630.1.92310 WP_000489630.1.92318 WP_000489630.1.92327 WP_000489630.1.92375 WP_000489630.1.92399 WP_000489630.1.92411 WP_000489630.1.92439 WP_000489630.1.92443 WP_000489630.1.92452 WP_000489630.1.92470 WP_000489630.1.92477 WP_000489630.1.92482 WP_000489630.1.92529 WP_000489630.1.92531 WP_000489630.1.92545 WP_000489630.1.92557 WP_000489630.1.92562 WP_000489630.1.92570 WP_000489630.1.92575 WP_000489630.1.92588 WP_000489630.1.926 WP_000489630.1.92628 WP_000489630.1.92633 WP_000489630.1.92649 WP_000489630.1.92669 WP_000489630.1.92671 WP_000489630.1.92676 WP_000489630.1.92705 WP_000489630.1.9271 WP_000489630.1.92729 WP_000489630.1.92734 WP_000489630.1.92738 WP_000489630.1.92754 WP_000489630.1.92758 WP_000489630.1.92806 WP_000489630.1.92823 WP_000489630.1.92879 WP_000489630.1.92890 WP_000489630.1.92893 WP_000489630.1.92926 WP_000489630.1.92929 WP_000489630.1.92939 WP_000489630.1.92975 WP_000489630.1.92987 WP_000489630.1.92988 WP_000489630.1.93007 WP_000489630.1.93022 WP_000489630.1.93059 WP_000489630.1.93061 WP_000489630.1.93076 WP_000489630.1.93086 WP_000489630.1.93101 WP_000489630.1.93103 WP_000489630.1.93105 WP_000489630.1.93111 WP_000489630.1.93121 WP_000489630.1.93136 WP_000489630.1.93155 WP_000489630.1.93168 WP_000489630.1.93184 WP_000489630.1.93213 WP_000489630.1.93215 WP_000489630.1.93221 WP_000489630.1.93223 WP_000489630.1.93239 WP_000489630.1.93275 WP_000489630.1.93302 WP_000489630.1.93339 WP_000489630.1.93350 WP_000489630.1.9336 WP_000489630.1.93365 WP_000489630.1.93376 WP_000489630.1.93387 WP_000489630.1.93410 WP_000489630.1.93469 WP_000489630.1.93511 WP_000489630.1.93512 WP_000489630.1.93524 WP_000489630.1.93543 WP_000489630.1.93577 WP_000489630.1.93596 WP_000489630.1.93604 WP_000489630.1.93635 WP_000489630.1.93650 WP_000489630.1.93657 WP_000489630.1.93662 WP_000489630.1.93691 WP_000489630.1.937 WP_000489630.1.93705 WP_000489630.1.9374 WP_000489630.1.93741 WP_000489630.1.9375 WP_000489630.1.93754 WP_000489630.1.93761 WP_000489630.1.93780 WP_000489630.1.9380 WP_000489630.1.93803 WP_000489630.1.93804 WP_000489630.1.93809 WP_000489630.1.93828 WP_000489630.1.93842 WP_000489630.1.93843 WP_000489630.1.93875 WP_000489630.1.9389 WP_000489630.1.93909 WP_000489630.1.93919 WP_000489630.1.93937 WP_000489630.1.93938 WP_000489630.1.93984 WP_000489630.1.93986 WP_000489630.1.9399 WP_000489630.1.93994 WP_000489630.1.94017 WP_000489630.1.94039 WP_000489630.1.94064 WP_000489630.1.94070 WP_000489630.1.94072 WP_000489630.1.94079 WP_000489630.1.94097 WP_000489630.1.94107 WP_000489630.1.94142 WP_000489630.1.94162 WP_000489630.1.94168 WP_000489630.1.94198 WP_000489630.1.94215 WP_000489630.1.94303 WP_000489630.1.9432 WP_000489630.1.94352 WP_000489630.1.94354 WP_000489630.1.94365 WP_000489630.1.94379 WP_000489630.1.94380 WP_000489630.1.94390 WP_000489630.1.9440 WP_000489630.1.94412 WP_000489630.1.94415 WP_000489630.1.94458 WP_000489630.1.94473 WP_000489630.1.94492 WP_000489630.1.94510 WP_000489630.1.94527 WP_000489630.1.94562 WP_000489630.1.94565 WP_000489630.1.94573 WP_000489630.1.94579 WP_000489630.1.94584 WP_000489630.1.94586 WP_000489630.1.94593 WP_000489630.1.94598 WP_000489630.1.94649 WP_000489630.1.94650 WP_000489630.1.94655 WP_000489630.1.94659 WP_000489630.1.94662 WP_000489630.1.94669 WP_000489630.1.94670 WP_000489630.1.94674 WP_000489630.1.94700 WP_000489630.1.94745 WP_000489630.1.94782 WP_000489630.1.94785 WP_000489630.1.94796 WP_000489630.1.94798 WP_000489630.1.94815 WP_000489630.1.94817 WP_000489630.1.94820 WP_000489630.1.94835 WP_000489630.1.94849 WP_000489630.1.94850 WP_000489630.1.94851 WP_000489630.1.94864 WP_000489630.1.94947 WP_000489630.1.94952 WP_000489630.1.94959 WP_000489630.1.94967 WP_000489630.1.94982 WP_000489630.1.94983 WP_000489630.1.95006 WP_000489630.1.95051 WP_000489630.1.95055 WP_000489630.1.95076 WP_000489630.1.95085 WP_000489630.1.95094 WP_000489630.1.95099 WP_000489630.1.95121 WP_000489630.1.95136 WP_000489630.1.95152 WP_000489630.1.9516 WP_000489630.1.95165 WP_000489630.1.95171 WP_000489630.1.95239 WP_000489630.1.95246 WP_000489630.1.95248 WP_000489630.1.95249 WP_000489630.1.9525 WP_000489630.1.95255 WP_000489630.1.95265 WP_000489630.1.9527 WP_000489630.1.95277 WP_000489630.1.95282 WP_000489630.1.95289 WP_000489630.1.9530 WP_000489630.1.95338 WP_000489630.1.95388 WP_000489630.1.95404 WP_000489630.1.95412 WP_000489630.1.95434 WP_000489630.1.95447 WP_000489630.1.95456 WP_000489630.1.95530 WP_000489630.1.95546 WP_000489630.1.95547 WP_000489630.1.95558 WP_000489630.1.95579 WP_000489630.1.95590 WP_000489630.1.95607 WP_000489630.1.95625 WP_000489630.1.95630 WP_000489630.1.95641 WP_000489630.1.95656 WP_000489630.1.95670 WP_000489630.1.95675 WP_000489630.1.95691 WP_000489630.1.95701 WP_000489630.1.95716 WP_000489630.1.95744 WP_000489630.1.95757 WP_000489630.1.95776 WP_000489630.1.95805 WP_000489630.1.95826 WP_000489630.1.95840 WP_000489630.1.9586 WP_000489630.1.95866 WP_000489630.1.95884 WP_000489630.1.95906 WP_000489630.1.95911 WP_000489630.1.95939 WP_000489630.1.95940 WP_000489630.1.95963 WP_000489630.1.96004 WP_000489630.1.96025 WP_000489630.1.96044 WP_000489630.1.96045 WP_000489630.1.9609 WP_000489630.1.96094 WP_000489630.1.96107 WP_000489630.1.96127 WP_000489630.1.96139 WP_000489630.1.96141 WP_000489630.1.96144 WP_000489630.1.96162 WP_000489630.1.96188 WP_000489630.1.96203 WP_000489630.1.96211 WP_000489630.1.96212 WP_000489630.1.9624 WP_000489630.1.96317 WP_000489630.1.96319 WP_000489630.1.9633 WP_000489630.1.96335 WP_000489630.1.96340 WP_000489630.1.96343 WP_000489630.1.96348 WP_000489630.1.96349 WP_000489630.1.96359 WP_000489630.1.96380 WP_000489630.1.96429 WP_000489630.1.9644 WP_000489630.1.96469 WP_000489630.1.96490 WP_000489630.1.96497 WP_000489630.1.96500 WP_000489630.1.96521 WP_000489630.1.96533 WP_000489630.1.96537 WP_000489630.1.96539 WP_000489630.1.96552 WP_000489630.1.96555 WP_000489630.1.96563 WP_000489630.1.96584 WP_000489630.1.96588 WP_000489630.1.96590 WP_000489630.1.96610 WP_000489630.1.96625 WP_000489630.1.96635 WP_000489630.1.9664 WP_000489630.1.96640 WP_000489630.1.96675 WP_000489630.1.9670 WP_000489630.1.96732 WP_000489630.1.96735 WP_000489630.1.9674 WP_000489630.1.96750 WP_000489630.1.96758 WP_000489630.1.96761 WP_000489630.1.96771 WP_000489630.1.96792 WP_000489630.1.96798 WP_000489630.1.96801 WP_000489630.1.96803 WP_000489630.1.96810 WP_000489630.1.9686 WP_000489630.1.96876 WP_000489630.1.96890 WP_000489630.1.96902 WP_000489630.1.96917 WP_000489630.1.96925 WP_000489630.1.96938 WP_000489630.1.96946 WP_000489630.1.96957 WP_000489630.1.96978 WP_000489630.1.96993 WP_000489630.1.97015 WP_000489630.1.97026 WP_000489630.1.97028 WP_000489630.1.97043 WP_000489630.1.97047 WP_000489630.1.97079 WP_000489630.1.97089 WP_000489630.1.97103 WP_000489630.1.97109 WP_000489630.1.97143 WP_000489630.1.97145 WP_000489630.1.97154 WP_000489630.1.97184 WP_000489630.1.97185 WP_000489630.1.97190 WP_000489630.1.97224 WP_000489630.1.97260 WP_000489630.1.97287 WP_000489630.1.97291 WP_000489630.1.97297 WP_000489630.1.97318 WP_000489630.1.97322 WP_000489630.1.97328 WP_000489630.1.97337 WP_000489630.1.97369 WP_000489630.1.97386 WP_000489630.1.97413 WP_000489630.1.97422 WP_000489630.1.97441 WP_000489630.1.97477 WP_000489630.1.97480 WP_000489630.1.97487 WP_000489630.1.97497 WP_000489630.1.97505 WP_000489630.1.97534 WP_000489630.1.97547 WP_000489630.1.97594 WP_000489630.1.97597 WP_000489630.1.97599 WP_000489630.1.97606 WP_000489630.1.97613 WP_000489630.1.97615 WP_000489630.1.97620 WP_000489630.1.97631 WP_000489630.1.97646 WP_000489630.1.97648 WP_000489630.1.97656 WP_000489630.1.97690 WP_000489630.1.97691 WP_000489630.1.97693 WP_000489630.1.97704 WP_000489630.1.97725 WP_000489630.1.97727 WP_000489630.1.97732 WP_000489630.1.97736 WP_000489630.1.9774 WP_000489630.1.9775 WP_000489630.1.97768 WP_000489630.1.97772 WP_000489630.1.97800 WP_000489630.1.97819 WP_000489630.1.97840 WP_000489630.1.97846 WP_000489630.1.97873 WP_000489630.1.97907 WP_000489630.1.9793 WP_000489630.1.97938 WP_000489630.1.97981 WP_000489630.1.97983 WP_000489630.1.97986 WP_000489630.1.9799 WP_000489630.1.97991 WP_000489630.1.98006 WP_000489630.1.98019 WP_000489630.1.98022 WP_000489630.1.98036 WP_000489630.1.9805 WP_000489630.1.98080 WP_000489630.1.98086 WP_000489630.1.98107 WP_000489630.1.9811 WP_000489630.1.98110 WP_000489630.1.98119 WP_000489630.1.98146 WP_000489630.1.98158 WP_000489630.1.98170 WP_000489630.1.98219 WP_000489630.1.98236 WP_000489630.1.9826 WP_000489630.1.98263 WP_000489630.1.98338 WP_000489630.1.98402 WP_000489630.1.9841 WP_000489630.1.98418 WP_000489630.1.98440 WP_000489630.1.98446 WP_000489630.1.98448 WP_000489630.1.98457 WP_000489630.1.98472 WP_000489630.1.98495 WP_000489630.1.9850 WP_000489630.1.98502 WP_000489630.1.98513 WP_000489630.1.98531 WP_000489630.1.98551 WP_000489630.1.98570 WP_000489630.1.98577 WP_000489630.1.98607 WP_000489630.1.98608 WP_000489630.1.98627 WP_000489630.1.98634 WP_000489630.1.98676 WP_000489630.1.98677 WP_000489630.1.98726 WP_000489630.1.98731 WP_000489630.1.98760 WP_000489630.1.98762 WP_000489630.1.9877 WP_000489630.1.98779 WP_000489630.1.98801 WP_000489630.1.98818 WP_000489630.1.98843 WP_000489630.1.98899 WP_000489630.1.9898 WP_000489630.1.9899 WP_000489630.1.99057 WP_000489630.1.99071 WP_000489630.1.99072 WP_000489630.1.99097 WP_000489630.1.99098 WP_000489630.1.99107 WP_000489630.1.99163 WP_000489630.1.99164 WP_000489630.1.99184 WP_000489630.1.9919 WP_000489630.1.99197 WP_000489630.1.99215 WP_000489630.1.99255 WP_000489630.1.99267 WP_000489630.1.99276 WP_000489630.1.99327 WP_000489630.1.99335 WP_000489630.1.99339 WP_000489630.1.99350 WP_000489630.1.99360 WP_000489630.1.99363 WP_000489630.1.99369 WP_000489630.1.99388 WP_000489630.1.99397 WP_000489630.1.99456 WP_000489630.1.99463 WP_000489630.1.99483 WP_000489630.1.99490 WP_000489630.1.99493 WP_000489630.1.9954 WP_000489630.1.99546 WP_000489630.1.99577 WP_000489630.1.99579 WP_000489630.1.99595 WP_000489630.1.99613 WP_000489630.1.99626 WP_000489630.1.99630 WP_000489630.1.99646 WP_000489630.1.99657 WP_000489630.1.99660 WP_000489630.1.99671 WP_000489630.1.99676 WP_000489630.1.99712 WP_000489630.1.99725 WP_000489630.1.99764 WP_000489630.1.99813 WP_000489630.1.99824 WP_000489630.1.99829 WP_000489630.1.99837 WP_000489630.1.99841 WP_000489630.1.99858 WP_000489630.1.99889 WP_000489630.1.9992 WP_000489630.1.99924 WP_000489630.1.99958 WP_000489630.1.99961 WP_000489630.1.99996 gi|207857907|ref|YP_002244558.1| gi|525829492|ref|YP_008252608.1| gi|550901920|ref|YP_008671012.1| 209261.t0363 220341.STY2735 272994.SPAB_00452 423368.SNSL254_A2689 439851.SeD_A2862 454169.SeHA_C2753 550537.SEN2475 550538.SG2526 99287.STM2494 gi|525837437|ref|YP_008254258.1| gi|378989875|ref|YP_005253039.1| gi|29140891|ref|NP_804233.1| gi|528820314|ref|YP_008361517.1| gi|378700398|ref|YP_005182355.1| gi|16765814|ref|NP_461429.1| gi|194444843|ref|YP_002041755.1| gi|378445913|ref|YP_005233545.1| gi|378954167|ref|YP_005211654.1| gi|488652914|ref|YP_007924717.1| gi|549480107|ref|YP_008614263.1| gi|161612753|ref|YP_001586718.1| gi|537435734|ref|YP_008480111.1| StR234 gi|538363111|ref|YP_008506396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]