SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379714458|ref|YP_005302795.1| from Corynebacterium pseudotuberculosis 316

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379714458|ref|YP_005302795.1|
Domain Number 1 Region: 716-831
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 9.81e-19
Family Hypothetical protein PA1324 0.0095
Further Details:      
 
Domain Number 2 Region: 854-963
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 2.88e-18
Family Hypothetical protein PA1324 0.011
Further Details:      
 
Domain Number 3 Region: 422-501
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 7.45e-17
Family Hypothetical protein PA1324 0.0099
Further Details:      
 
Weak hits

Sequence:  gi|379714458|ref|YP_005302795.1|
Domain Number - Region: 325-374
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.071
Family Heme-dependent catalases 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379714458|ref|YP_005302795.1|
Sequence length 1111
Comment hypothetical protein Cp316_0179 [Corynebacterium pseudotuberculosis 316]
Sequence
MNEVSPFNQPATKRLGRIASAVVTATSVTFSGFLVPTASAEAASAYSDNIGRNEIGPETL
EKLKPEIVGGEQSVSVGDSVTYKYTVKTGFPQDPNNVTAQRWVRLVITQDPKVPFTESPA
AGKFGIPDNAVVTKTGDNEWTVVLGAEYEAWQYGTSQAVDDHNNGLFKVNNSMHTLWNAD
NALKAPAWTPPAELTIAIPAKVNNVDTAPSAGSLTVTSGRLADVALRDDLATATFVSNDG
QGSCTWDSVYQTKLLKEDIGYWVENVIISSDPESVKDYPLLPMAYRDMRRYRPTLTSGEV
FVGNKSIGKVNPVNTGDRNLSGYPIGELVITGNVPPFTSKEWLNPKETVRVNYRFTNPCG
SKVTAESVKNPSGLVPATDPSATGPGLRLEPDYTYVQASGVYVGLIRPPEDASATAQFVF
NQDVVSLGDYVWFDRNADGKQGDATTEPGVAGVQVSLLDENGKPFNKPGTSEPYTIITDE
SGKYLFEKLPKGKYKVQFDASKVPADKLPAGVPSFSDFTSKSADNGQSNGTDSDVTPGSL
ISTTDVVDLQQDRTDIDAGLIAKTRFSVSKVLDGTDAGNHIGTTARELQDGKLIVDHKIT
VKNETPGMPGKAPQVLDQPLSVPGFEVESLTVDGKPAQKEEKSYLVSAEKDFTADQERQE
YSVKVTYKRTADNAATGALTKAEADAIGECSDQSDTTKGIVNKVYLGNENNEADADAEKE
KNNWDCVPVKGTDEPVGSVSVGDFVWVDSNNDGIQDADEKGLAGVELQIVDSEGKPVKDI
NGEEVKNVTTAADGKYSFDNLPTLEKGKHYTVKVVAVPTGYEPTKTGQGTEDNDSSKDSA
ETYKDLSENGAKDDSLDFGFVETKPEAPGSVSVGDFVWVDANENGIQDEDEEGLDGVTLK
IVGPDGAPVTDVNGNPVKDVTTRADGKYTFSDLPVLEDGQKYTVKVVEVPEGYEPTKTGQ
GTTETDSSTDQAETVLDLTKPGAEDNSLDFGFIKIQELEIPDPFNEEDSSFNWKYLIPLA
LIPVIGALAWGSSQGSSSPSTPAAPAPGAPKESGSATSPATAAPQSPATTAPKAPMKKQL
AATGASVLYTLLVALLLVVAGVFLVRLRRRD
Download sequence
Identical sequences A0A1L6CXX2
gi|379714458|ref|YP_005302795.1| WP_014366356.1.16076 WP_014366356.1.38385 WP_014366356.1.38411 WP_014366356.1.40681 WP_014366356.1.43256 WP_014366356.1.56904 WP_014366356.1.6216 WP_014366356.1.6597 WP_014366356.1.73584 WP_014366356.1.75733 WP_014366356.1.85367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]