SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379714465|ref|YP_005302802.1| from Corynebacterium pseudotuberculosis 316

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379714465|ref|YP_005302802.1|
Domain Number 1 Region: 19-508
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 9.55e-186
Family Heme-dependent catalases 0.000000000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379714465|ref|YP_005302802.1|
Sequence length 512
Comment catalase [Corynebacterium pseudotuberculosis 316]
Sequence
MNSPVDPILGAGERTEPVAYTTREGGQPVPSENISITAGPQGASVLNDLHLIEKLAHFNR
ERVPERNPHAKGHGAFGELHITEDVSAYTKAKLFQKGTVTPMAIRFSTVAGEQGSPDTWR
DVHGFALRFWTQDGNYDIVGNNTPTFFLRDAIKFPDFIHSQKRLGRNGLRDADMQWDFWT
RTPESAHQVTYLMGDRGTPKTSRHQDGFGSHTFQWINEEGKPVWVKYHFKSRQGWDTFTD
AEAQEMAGKNADHHREDLYNAIAHGDFPIWDVKVQIMPFEDAENYRWNPFDLTKTWSQKD
YPLVDVGYFVLNRNPKNFFTQIEQLALDPSNLVPGVGLSPDRMLMARAFAYADAQRTRIG
TNYRQLPINQPVVPVNTYEHEGAMAYQFNPADAPVYSPNRYSKGAGYLDDGETSSSGITY
GQASDLFVNPDPHGTDLTRAAYVKHAEDDDFIQAGILYREVFDDGEKERFVDNVTNAMAG
ISPEVEERVYWYWTQVDANLGAEIKRVFATKK
Download sequence
Identical sequences A0A1L6CXU7
WP_014366361.1.13534 WP_014366361.1.16076 WP_014366361.1.23262 WP_014366361.1.38411 WP_014366361.1.40681 WP_014366361.1.43256 WP_014366361.1.56904 WP_014366361.1.6216 WP_014366361.1.6597 WP_014366361.1.73584 WP_014366361.1.75733 WP_014366361.1.81226 WP_014366361.1.85367 gi|387139829|ref|YP_005695807.1| gi|379714465|ref|YP_005302802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]