SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379715417|ref|YP_005303754.1| from Corynebacterium pseudotuberculosis 316

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379715417|ref|YP_005303754.1|
Domain Number 1 Region: 1-207
Classification Level Classification E-value
Superfamily Formyltransferase 5.49e-58
Family Formyltransferase 0.00000583
Further Details:      
 
Domain Number 2 Region: 210-312
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 4.08e-25
Family Post formyltransferase domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379715417|ref|YP_005303754.1|
Sequence length 313
Comment methionyl-tRNA formyltransferase [Corynebacterium pseudotuberculosis 316]
Sequence
MRLIFAGTPEPAVVALEKLLDSDHEVVAVLTRPDAPKGRGRTLQPSPVAALAQEHGIEVL
TPTSIKPDTPDGEVFRSRLEELSPDCIPVVAYGNLITQDLLDAVPHGWINLHFSLLPAWR
GAAPVQAAIRHGDPVTGVTTFRIDQGLDTGDILNTLVEPISPTDTSDDVLTRLAYAGADL
LVKTMDDLASGKATPRPQVGEASYAHKILTEDAKVNWNATAVDIDRLIRSVTPGPGAWTM
LGQQRFKLGPVTYLSAEECSADRGELIIEKNRVLVGTSHGCVKLGMIQPQGKKRMQASDW
ARGLHNKEGLRFE
Download sequence
Identical sequences gi|386740451|ref|YP_006213631.1| gi|379715417|ref|YP_005303754.1| gi|387140714|ref|YP_005696692.1| gi|387138717|ref|YP_005694696.1| WP_014367111.1.10260 WP_014367111.1.11204 WP_014367111.1.13534 WP_014367111.1.16076 WP_014367111.1.23262 WP_014367111.1.24212 WP_014367111.1.27807 WP_014367111.1.3373 WP_014367111.1.38385 WP_014367111.1.38411 WP_014367111.1.40681 WP_014367111.1.43256 WP_014367111.1.45686 WP_014367111.1.56904 WP_014367111.1.58647 WP_014367111.1.61967 WP_014367111.1.6216 WP_014367111.1.6597 WP_014367111.1.73584 WP_014367111.1.75733 WP_014367111.1.80150 WP_014367111.1.8025 WP_014367111.1.81226 WP_014367111.1.85367 WP_014367111.1.88492 WP_014367111.1.91917 WP_014367111.1.9720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]