SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379714795|ref|YP_005303132.1| from Corynebacterium pseudotuberculosis 316

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379714795|ref|YP_005303132.1|
Domain Number 1 Region: 74-315
Classification Level Classification E-value
Superfamily SIS domain 4.45e-26
Family mono-SIS domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379714795|ref|YP_005303132.1|
Sequence length 328
Comment hypothetical protein Cp316_0530 [Corynebacterium pseudotuberculosis 316]
Sequence
MNTQEISHDSESAAVPTHSYDPEVVAFYDIAHEGAQLRVVAEFVRSGGLDAVQGTQPRSV
VVVTTEAIATHSAHVSIALHAPLKVPVIVTAELPRYVGPLDIVIVATERSSSEHLSQALT
TAMRRGCMVILVSASGGMLHKDAAQEAVVVPSLPLIEGPSPLRIIAVVMAVLALLEQDQE
RTATVLEESASHVDAEIMQCSPEYGEDANRARQLAQITGHIIHTGTTASAVAVANLIAVL
WTSYGKESTSLPAAELGAALGRFSYAVKDIFFDPDLDKAPTGQSLKTIAWCEPEPDAWER
TEHIDAGSTGTALRMIARGFAATAFISS
Download sequence
Identical sequences A0A1L6CZP4
gi|389849862|ref|YP_006352097.1| gi|387138114|ref|YP_005694093.1| gi|387140134|ref|YP_005696112.1| gi|379714795|ref|YP_005303132.1| WP_014366610.1.10260 WP_014366610.1.13534 WP_014366610.1.16076 WP_014366610.1.23262 WP_014366610.1.27807 WP_014366610.1.38385 WP_014366610.1.38411 WP_014366610.1.40681 WP_014366610.1.43256 WP_014366610.1.56904 WP_014366610.1.6216 WP_014366610.1.6597 WP_014366610.1.73584 WP_014366610.1.75733 WP_014366610.1.81226 WP_014366610.1.85367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]