SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410669323|ref|YP_006921694.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410669323|ref|YP_006921694.1|
Domain Number 1 Region: 2-193
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.93e-50
Family Phosphate binding protein-like 0.00026
Further Details:      
 
Domain Number 2 Region: 202-289
Classification Level Classification E-value
Superfamily ACT-like 3e-25
Family Phenylalanine metabolism regulatory domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410669323|ref|YP_006921694.1|
Sequence length 293
Comment prephenate dehydratase [Methanolobus psychrophilus R15]
Sequence
MIIGVLGPRGSYTEKAAQQWLAEKRSNECRIKCNDGYEGDLALEYCEDIEDVFSFLRACS
LDIGLVPVENSIEGSVGITLDMLLEHDVVIIGETVVAIEHCLLSKGRKEKIKIILSHPQA
LAQCRHFIKENFKGVELRTTGSTSHAARLATEFEEMAAIASRESAQTYGLNVLLSNIQDR
EHNHTRFLTIVRSDSSSIYSNHIGNAYKTSIILYLDRDRPGALYEILGEFSLRNINLTRI
ESRPSKNKLGDYLFYVDLEGSTSDDNIKEAIYNIESKVGMLKMLGSYPASNPV
Download sequence
Identical sequences K4MIY0
WP_015052052.1.66729 gi|410669323|ref|YP_006921694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]