SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410670008|ref|YP_006922379.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410670008|ref|YP_006922379.1|
Domain Number 1 Region: 9-102
Classification Level Classification E-value
Superfamily GlnB-like 1.08e-17
Family Prokaryotic signal transducing protein 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410670008|ref|YP_006922379.1|
Sequence length 132
Comment nitrogen regulatory protein P-II [Methanolobus psychrophilus R15]
Sequence
MSNENDLVLIVTIVKKGWGDKVVKASRKAGARGGTIIFGRGTGVHENKSLLGMLIEPEKE
IVLTLSEHSNADAIIDSINRNVGLNKPGCGLGFVVPLERVFGTAHILCDLHQQCDLHSPV
ADEEVSDRRDKT
Download sequence
Identical sequences K4MLD5
WP_015052734.1.66729 gi|410670008|ref|YP_006922379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]