SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410670976|ref|YP_006923347.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410670976|ref|YP_006923347.1|
Domain Number 1 Region: 6-55
Classification Level Classification E-value
Superfamily Hypothetical protein YjbJ 0.00000000000209
Family Hypothetical protein YjbJ 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410670976|ref|YP_006923347.1|
Sequence length 59
Comment hypothetical protein Mpsy_1772 [Methanolobus psychrophilus R15]
Sequence
MKSSTKDKVEGNIQKIKGEVKESVGELINDPSLKAEGTVEKTEGEAQEKVGQIKQVLGK
Download sequence
Identical sequences K4MF90
gi|410670976|ref|YP_006923347.1| WP_015053689.1.66729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]