SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410671298|ref|YP_006923669.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410671298|ref|YP_006923669.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily GlnB-like 3e-29
Family DUF190/COG1993 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410671298|ref|YP_006923669.1|
Sequence length 110
Comment hypothetical protein Mpsy_2095 [Methanolobus psychrophilus R15]
Sequence
MRALLLRIYLSENDMYKGKSAHHAVLGFLKEEGIAGATAHHCIEGYGVHEKIHTASVLRL
GTNLPVIIQAVDREEKIRDIIPELKRILPGKLIIIEEIEIVSGERFTEIS
Download sequence
Identical sequences K4MR05
WP_015054007.1.66729 gi|410671298|ref|YP_006923669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]