SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410671688|ref|YP_006924059.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410671688|ref|YP_006924059.1|
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.33e-66
Family Phosphate binding protein-like 0.0000206
Further Details:      
 
Domain Number 2 Region: 211-300
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 5.75e-18
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410671688|ref|YP_006924059.1|
Sequence length 306
Comment hydroxymethylbilane synthase [Methanolobus psychrophilus R15]
Sequence
MIIGTRGSDLALAQATSIERKLAELGVQTTRKIIKTTGDTFTDRPLHEVAGVGAFVRELD
DRMLEGDVDIAVHSMKDMPTVRPERLSTSAVIKRDSPCDVLLTTDGSKLEELPENAIIGT
TSMRRRAQILRYRPDLAVHDLRGNINTRIRKLEEGQYDGILLAEAGLQRMNWDLDVQRLD
PHHFCPSANQGTIAVVTVAGSEAEKVTSKLDHQKTRIETSIERIVVAYVEGGCTAPVGSF
THFINDNELHVLAEVLSLDGSEQVRIDEVIPVEGYESYARELGMRMVELGGKELVQQAVC
QLNSQI
Download sequence
Identical sequences K4MSG4
gi|410671688|ref|YP_006924059.1| WP_015054397.1.66729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]