SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410671965|ref|YP_006924336.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410671965|ref|YP_006924336.1|
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily CheY-like 3.98e-33
Family CheY-related 0.00018
Further Details:      
 
Weak hits

Sequence:  gi|410671965|ref|YP_006924336.1|
Domain Number - Region: 207-265
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.00575
Family MJ1460-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410671965|ref|YP_006924336.1|
Sequence length 268
Comment response regulator receiver [Methanolobus psychrophilus R15]
Sequence
MNIELLRAYLEDTYEVISADNGHVALEMVKSQRPDIILLDVMMPDINGYQVCEKLKLDPA
TQFIPVIMVTALSGRNDWINGIEAGADEFLTKPVNKLELQTRIHSLLRIKNLHADLMAEK
NKLDLQNRIRSVLTQIIPTLLRTLPPEQKGIVIHQMIDMVVDAIMENTAPENNLAGYETV
GDLCCQIINQLGANFEVDTCEDSKNCTIKGNLCPWGREEARSNPILCTISRGIFSRVANM
RGDDLEVDVVETMGNGDECCLFEINRLD
Download sequence
Identical sequences K4MG13
gi|410671965|ref|YP_006924336.1| WP_015054671.1.66729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]