SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410672039|ref|YP_006924410.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410672039|ref|YP_006924410.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily GlnB-like 6.3e-35
Family Divalent ion tolerance proteins CutA (CutA1) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410672039|ref|YP_006924410.1|
Sequence length 101
Comment CutA1 divalent ion tolerance protein [Methanolobus psychrophilus R15]
Sequence
MYIEIHTTVRDMEEARKIASVLVEKKLAACVNMYPVTSLYRWEGKIEEDEEVALSIKSTS
EKSGDIMRTIRALHSYDLPAITYWEMKGDVEYLEWIKDSTR
Download sequence
Identical sequences K4MIN0
gi|410672039|ref|YP_006924410.1| WP_015054745.1.66729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]