SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Didex1|8347|gm1.8347_g from Didymella exigua CBS 183.55 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Didex1|8347|gm1.8347_g
Domain Number 1 Region: 72-291
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-45
Family C-terminal domain of adrenodoxin reductase-like 0.00000905
Further Details:      
 
Domain Number 2 Region: 3-128,297-370
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000453
Family C-terminal domain of adrenodoxin reductase-like 0.00066
Further Details:      
 
Weak hits

Sequence:  jgi|Didex1|8347|gm1.8347_g
Domain Number - Region: 334-442
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00033
Family N-terminal domain of adrenodoxin reductase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Didex1|8347|gm1.8347_g
Sequence length 445
Sequence
MYEQLPVPYGLVRFGVAPDHPEVKNCQGTFEEVAQSPRFNYIGNVRVGHDIELLKMKPHY
DAMLFSYGADEDRRLGIPGEDLNGVFSARAFVGWYNGLPQFQNLQPDLQSGEHAVVVGQG
NVALDVARILLAPLDHLRKTDITEQAIQTLAESKIKHVRVVGRRGPLQVAFTVKEARELM
KIPYVAFHNIDRSFYPAEIKKLPRVQKRTAEVLLKGSIATPEEVERSWTLDFLKAPRSMN
AEEGSNHLSSMTFWRQQFLPDADPLDPSARVQATEEEMTVPASLAFRSVGYKSTAIPGLS
DLGVPFDSKLGIIPNDIHGRIVSPSVGPGSLTAGHIPGLYCAGWVKRGPTGVIASTMQDA
FTSADIIAHDWENNAKFLNDSNGPDKSTHLGWVGVKAEVESKGVRPLSWADWKKIDEAER
VRGKEKGKEREKFASVAEMLKALDA
Download sequence
Identical sequences jgi|Didex1|8347|gm1.8347_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]