SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Didex1|309682|CE204554_12175 from Didymella exigua CBS 183.55 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Didex1|309682|CE204554_12175
Domain Number 1 Region: 59-511
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.99e-101
Family Pyridoxal-dependent decarboxylase 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Didex1|309682|CE204554_12175
Sequence length 514
Sequence
MTASHTNGNGTEPHLGRSEEVKDLLDAVQELIIPFIAAADRDAETKHTGHGLAIKGGAPR
TALVEHHPPKKLEALLQDHLKIGDHVETGKHRLIDLVGSVLKYSVNTWDQGFLDKLYAST
NAVGLVSELLLAVLNTNVHVYQVSPVLTLIEKATAKYLATLFGYPSQYSGGISQPGGSAS
NSSAIVIARNTLYPETKTEGNAAHNFTLFTSAHGHYSVEKAANLFGLGSKNVISVPVDEA
GRMLPSELERLVKQSRERGETPFFVNATAGTTVHGSYDPFRALSAVCKKENLWLHIDGSW
GGSVIFNRELASTRLDGCELADSIAINPHKMLGAPITCSFLLGRDMRTFHNALTLPAGYL
FHSAGADVNDMYDLADLTPQCGRRGDALKMFLMLQYYGPRYFSDLVARGFANANYLLQKL
KQQGDFVTISPEPVPCLQVCFYFARNGTLGEDAEHNGRITSEIAHRLIPRGFMIDFAPGE
KGRFFRVVVNGGTRTGTLDGLVKALVETAADLGY
Download sequence
Identical sequences jgi|Didex1|309682|CE204554_12175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]