SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Didex1|425806|fgenesh1_kg.50_#_32_#_Locus5408v1rpkm16.36 from Didymella exigua CBS 183.55 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Didex1|425806|fgenesh1_kg.50_#_32_#_Locus5408v1rpkm16.36
Domain Number 1 Region: 2001-2293
Classification Level Classification E-value
Superfamily BEACH domain 4.84e-117
Family BEACH domain 0.0000000363
Further Details:      
 
Domain Number 2 Region: 1830-1883,1910-1960
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-24
Family PreBEACH PH-like domain 0.029
Further Details:      
 
Domain Number 3 Region: 2354-2468,2520-2559,2605-2631
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.6e-23
Family WD40-repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 382-518,547-596
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000135
Family Laminin G-like module 0.064
Further Details:      
 
Weak hits

Sequence:  jgi|Didex1|425806|fgenesh1_kg.50_#_32_#_Locus5408v1rpkm16.36
Domain Number - Region: 749-831,884-934,997-1084
Classification Level Classification E-value
Superfamily ARM repeat 0.0121
Family Armadillo repeat 0.056
Further Details:      
 
Domain Number - Region: 996-1142,1199-1221,1414-1558
Classification Level Classification E-value
Superfamily ARM repeat 0.0374
Family Armadillo repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Didex1|425806|fgenesh1_kg.50_#_32_#_Locus5408v1rpkm16.36
Sequence length 2637
Sequence
MATSTRPHRSSTAASRVPPTNNQIVELRGLADDLLRAAEPSPPTADRLQGQSHILRLMRQ
LLIDSSAQTHTKDAFRHVRGFEGLLTTLRSLAGFYRPVARPSPDRIDFFEVIKAALDVLS
DALNEHAGNRRFFSKRVEDGGWNALEQALGSTGILGGQSDPKHDDAGQEQLFGNLFAFAL
GEEAMTRMFRDINKKLEAGTPATQQGKALADSGDSQPTDVAVTSPRSVYGESGVDFDPLR
THLRKLFSGNEVLQNPDIMPAIFHFWRGLSGEDAPGGESKPLSVAVLLAVLEITKLSSYN
KAALHITGVLSFVLPLLFENKCAPTEAGLLQELADSLVEYGINRLDDAYYLFRQAASSEQ
AAEFLHRGMQTSRAPHFIQFDLSLHGFSAIELPDLGRPFPPVSQGGGYTFATWMRVDKYD
PNCHTTLFGAYDDTQTCFLMAYLEKDTRCFILQTYMGHASGVVPSVRFKKAPRFEEGRWY
HIAVVHRRAKGMGMGSHKASIFVDGEFTETTKAHYPSHPPVLDSSQDSFASMTSSTSKHH
ILAFLGTPRNLAPRLGRNVLTSKMSMASFHLFSEPLSDELIAVYHKLGPRYSGNFQDRLG
SFQTYRTSAELHVHNEILHPGREERSDIVTAIRSNAGYLMPEAKILLSFSPSSVMDDDDR
NAIDESQLIRSLSRDSARSLHKYTRAHSTPIIINAAVPSINDALSLARGFGRLSGDPVVV
VPQSLDDAIWRIGGCAAVGLKLVHAAQSLKSVLRAVRILLEAVEGNWRNCEAMEQSNGFA
ILAEVLRQKIGFAMGGLVMRNASSIDVTPEQCEEFVAQLLSVILHFVGYDERHPEDSLII
NPLAYRVLLVDLEIWRRATSLDTQRKYYTQFIHFAKGSKHHHYNAKRFHRIRVVKRLTDA
LKGESFTPQTFPLFLESFKALLHINFNGENARSLSLFVTYALHDSRASYAKRALRPQAST
LRLRRGTPPNLTPAFTPRSSSPSSITPESSPLSLPDLGIAILRLLSEFLCDAHSPHEIVR
FAKNVTGKWLLYLLAETDQRVVVLGARILARLLVTNGPPYVKKFGDKTGGFTILKNRLRH
WWNTPGIWTICFAILFDRDVATIDFERDFDVFNLVDIFMTHSPQSKLRIAYPEIFPVITA
MLDTGLRAIVRDRETGNTERPKDGDTEGTPSRGRRRTMSLNAKQPTVDTRAPQSERLSNY
AVVLNSAIQFLSELHARSQVFRDYANTSNYVQELLFVLYPVIVTSDSVSAETELLSRGSA
LTFEGQDVVIQPVSGASSQQTPIIRTNNAAAAPSPGTQRVIPFRRASSFVLISADKSKKA
AKHPPLNPIMSPRNTAPMAMKVGSSVVEAMLEVVLDVFKEQLFTRKDFPGLGLFMKTPPG
FQEHQAYFESYILRQILTSVKNALQLDQNLLHEPRVLINLSRFVSHISEAVFEGWFLQGA
EPLLDFTGFLLEYLERPDISAIKSVRLCTQAIQTMRATFLKVALLQLAEPDDSEDGFTTT
SIIEKMVYWQPIIMSSANTDTFSLKMICYLFFTKLFSHYELVRLAAANFWRLLLVQKPHE
TSSILGNAIQSDKKNLFEGFLKLAELDNETFLQWFDEHKTELDTLFYGSLTRTWEEFAHE
QNKRTEETSTKRIGKRKEKLKQWQAEELTSESIWNHHENSTGHWRSNIHASERIKHQRVL
QDQQDNATYLQTVLAKLDHQLKGPCALFDNSPPAKWRLDETEGRDRRRMRIILDNTNRDQ
QYQPKRKDTDTLGRLKLDTNVAPITAKDALGVTPIGRRSGTPSTMTKEESQQEDGSGSEE
DFEMVDALYEDEDGFEDKNRKVMRSLNRGDQVQYVCNISRVVGLEAIEGLLIVGKDCLYL
LDDFFQRSDGEIVRVWQAPPDERDPYVQVIAGKEAVTNRRPPPRTQEESARHWKWSEVIS
ISKRRFLHRDVAIEVFFDDGRSYLLTAISAQARNDIHGRVLQRASHVVNPEKLANSEIVW
RLDSLRNVEEAPQTLGSRFASAFSSVTSHPATKKWLKGEVSNFHYLMFVNTLAGRTFNDL
TQYPVFPWVISNYESEELDLTDPRNFRDLSKPIGIQHPRQEQSIRERFSSFAEMGDPDHA
FHFGTHYSSAMTVASYLMRLQPYSAAFFLIQGGTWDHADRMFYSIQNAWESASNKNMADV
RELTPEFFFLPDFLTNVNGYNFGLRSDESSIDNVQLPPWAKGDPAIFIAKQREALESPHV
SANLHHWIDLIFGHKQRGEAAVEAANVFHWMTYQGAIDLDSITDEKERAQKISVINNFGQ
TPTQVFQRPHPSRENVTKATKLDTAAESLHRVPGTLLDAQDRISSLNYIAKSDKLLCSAP
FRHNLPPHYNVYMEWGFTDGSVRFYDSHSKRLLGLFEHLHSGQLTTSLFVDGRTLITAGT
DCTLAVWNIIRAEKGHIELQHLTSLFGHKSPVISLAASRGFSAFLSADQDGKVSMWDLNR
NEFVRELDLGPRQRRARTPVQAARINSATGHIILAIGQRLIVTTLNGTVLFDEDVCDGDD
DTEGITSIAVYEGVGNEWCERELIFTGHRRGIVKIFHLTPNPKIPFAATNPSSAAHTTPN
RSSSTWSIDLVNVLAHGDPMIERTAAPITCILPLERSVYTGDEDGRVYEWDCVQRHH
Download sequence
Identical sequences jgi|Didex1|425806|fgenesh1_kg.50_#_32_#_Locus5408v1rpkm16.36

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]