SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Didex1|89052|fgenesh1_pg.3_#_126 from Didymella exigua CBS 183.55 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Didex1|89052|fgenesh1_pg.3_#_126
Domain Number 1 Region: 88-331,407-542
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.35e-44
Family Cystathionine synthase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Didex1|89052|fgenesh1_pg.3_#_126
Sequence length 564
Sequence
MPGPGNPYLAIADAELCSEAFARREDEKDELSALRKEFVIPTKGDLRNKKYGFQQQADAT
RNGDDDNDDDDDDNDDNDDNDNDNEEAIYFCGNSLGLQPRRTRDYVNRCLETWASKGVFG
HFTDYEDGLPPWLHLDDATKAQSASIVGALPSEVAVMQTLTANLHLLMSSFYRPTADRWK
IIIEGKAFPSDHYAALSQIAHHNLPPSSLVTISPPSDASPYLSTEHILSVISQHAATTAL
VLLPGIQFYSGQFLDMELITRHCHSNGIPIGWDLAHAVGNVELKLHEWNVDFAAWCNYKY
MNGGPGVIGGLFVHEMHGRVDPAPTAPSGTSTSSTAAGTSTAASTAPASTPASTTPASTT
PASTAAPNPAPPSATQLTYRPRLSGWWGSDKTSRFAMDNSFVPIPGASGFQLSNPSALDM
ASVLASLAVFSQTSMSALRARSERLTGYLEARLLRYPAPSSGATQPKPPYSIITPSRPCE
RGAQLSVRLAPGLLDGVQAALSARGVVVDERKPDVLRVAPAPLYNSFMDVHRFVAVFHDA
CRRALASGQTARAETRRRAGVAKT
Download sequence
Identical sequences jgi|Didex1|89052|fgenesh1_pg.3_#_126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]