SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15643467|ref|NP_228513.1| from Thermotoga maritima MSB8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15643467|ref|NP_228513.1|
Domain Number 1 Region: 214-317
Classification Level Classification E-value
Superfamily Protein-L-isoaspartyl O-methyltransferase, C-terminal domain 2.42e-67
Family Protein-L-isoaspartyl O-methyltransferase, C-terminal domain 0.000000835
Further Details:      
 
Domain Number 2 Region: 15-175
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.1e-60
Family Protein-L-isoaspartyl O-methyltransferase 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15643467|ref|NP_228513.1|
Sequence length 317
Comment protein-L-isoaspartate O-methyltransferase [Thermotoga maritima MSB8]
Sequence
MREKLFWILKKYGVSDHIAKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQ
PSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNV
ERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDEVPETWFTQLKEGGRVIVPINLKLS
RRQPAFLFKKKDPYLVGNYKLETRFITAGGNLGNLLERNRKLLREFPFNREILLVRSHIF
VELVDLLTRRLTEIDGTFYYAGPNGVVEFLDDRMRIYGDAPEIENLLTQWESCGYRSFEY
LMLHVGYNAFSHISCSI
Download sequence
Identical sequences A0A101FBT7 A0A117L3K9 A5IJ82 D2C6L1 G4FDC0 Q56308
1dl5A 1dl5_A 1dl5_B 282574 gi|148269371|ref|YP_001243831.1| gi|15643467|ref|NP_228513.1| gi|15643467|ref|NP_228513.1| NP_228513.1.35502 WP_004081036.1.100023 WP_004081036.1.18251 WP_004081036.1.29620 WP_004081036.1.43545 WP_004081036.1.44660 WP_004081036.1.45724 WP_004081036.1.5118 WP_004081036.1.51363 WP_004081036.1.51822 WP_004081036.1.56403 WP_004081036.1.75526 WP_004081036.1.79805 WP_004081036.1.89131 gi|281411932|ref|YP_003346011.1| 243274.TM0704 390874.Tpet_0226 590168.Tnap_0501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]