SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478464386|ref|YP_007741078.1| from Chlamydia trachomatis L2b/CV204

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478464386|ref|YP_007741078.1|
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.92e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478464386|ref|YP_007741078.1|
Sequence length 116
Comment Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) [Chlamydia trachomatis L2b/CV204]
Sequence
MSNFQKEEQGQTGILHLQGKLDGVSSPAVQESISESLSNGMKNIILDCGDLDYISSAGIR
VLLQSYHQVGKNAGKIALTSVSKTVEQTLYVTGFLSYFKVFDSVNEALQALAKENS
Download sequence
Identical sequences A0A0E9E330 A0A0H2X292 A0A0H3ML58 G4NNG6 O84431
gi|527322936|ref|YP_008349133.1| gi|478459883|ref|YP_007733951.1| gi|385242720|ref|YP_005810559.1| gi|527325030|ref|YP_008351224.1| gi|478454456|ref|YP_007716835.1| gi|237802851|ref|YP_002888045.1| gi|237804773|ref|YP_002888927.1| gi|339626100|ref|YP_004717579.1| gi|386262780|ref|YP_005816059.1| gi|478469795|ref|YP_007723075.1| gi|389858995|ref|YP_006361236.1| gi|478451751|ref|YP_007715057.1| gi|478472493|ref|YP_007733060.1| gi|385246329|ref|YP_005815151.1| gi|385241797|ref|YP_005809637.1| gi|478453564|ref|YP_007717726.1| gi|482545793|ref|YP_007851711.1| gi|478475201|ref|YP_007724870.1| gi|76789157|ref|YP_328243.1| gi|385245404|ref|YP_005814227.1| gi|478448151|ref|YP_007722185.1| gi|478470694|ref|YP_007729335.1| gi|478462590|ref|YP_007738411.1| gi|478458982|ref|YP_007732166.1| gi|478455362|ref|YP_007727552.1| gi|471328599|ref|YP_007540124.1| gi|478471585|ref|YP_007740188.1| gi|385239942|ref|YP_005807784.1| gi|478461685|ref|YP_007736635.1| gi|389858119|ref|YP_006360361.1| gi|527327804|ref|YP_008353995.1| gi|478463489|ref|YP_007739301.1| gi|478450851|ref|YP_007721293.1| gi|478464386|ref|YP_007741078.1| gi|527325955|ref|YP_008352148.1| gi|482546737|ref|YP_007852653.1| gi|15605151|ref|NP_219936.1| gi|478474298|ref|YP_007730374.1| gi|478473395|ref|YP_007734843.1| gi|166154637|ref|YP_001654755.1| gi|385243631|ref|YP_005811477.1| 272561.CT424 315277.CTA_0463 471472.CTL0683 471473.CTLon_0679 580049.JALI_4251 672161.CTB_4251 gi|527323897|ref|YP_008350093.1| gi|166155512|ref|YP_001653767.1| gi|527318247|ref|YP_008344449.1| gi|478428560|ref|YP_007541000.1| gi|478456278|ref|YP_007726661.1| gi|478449054|ref|YP_007723977.1| gi|478452650|ref|YP_007720398.1| gi|527321993|ref|YP_008348191.1| gi|478458080|ref|YP_007731265.1| gi|478449950|ref|YP_007719507.1| gi|527319168|ref|YP_008345369.1| gi|478467085|ref|YP_007718617.1| gi|527321043|ref|YP_008347242.1| gi|385270118|ref|YP_005813278.1| gi|527326877|ref|YP_008353069.1| NP_219936.1.57406 WP_009871778.1.100466 WP_009871778.1.100644 WP_009871778.1.100883 WP_009871778.1.101362 WP_009871778.1.101735 WP_009871778.1.102133 WP_009871778.1.11148 WP_009871778.1.11717 WP_009871778.1.11732 WP_009871778.1.13674 WP_009871778.1.13766 WP_009871778.1.13837 WP_009871778.1.1409 WP_009871778.1.14786 WP_009871778.1.14984 WP_009871778.1.15381 WP_009871778.1.17082 WP_009871778.1.17422 WP_009871778.1.18643 WP_009871778.1.1923 WP_009871778.1.19304 WP_009871778.1.20022 WP_009871778.1.20093 WP_009871778.1.22210 WP_009871778.1.25195 WP_009871778.1.25246 WP_009871778.1.27753 WP_009871778.1.27980 WP_009871778.1.28239 WP_009871778.1.29171 WP_009871778.1.30792 WP_009871778.1.31128 WP_009871778.1.31373 WP_009871778.1.32156 WP_009871778.1.32801 WP_009871778.1.32856 WP_009871778.1.35043 WP_009871778.1.36244 WP_009871778.1.36518 WP_009871778.1.3661 WP_009871778.1.37417 WP_009871778.1.37673 WP_009871778.1.37956 WP_009871778.1.38181 WP_009871778.1.38504 WP_009871778.1.38794 WP_009871778.1.38813 WP_009871778.1.39258 WP_009871778.1.40272 WP_009871778.1.40464 WP_009871778.1.40808 WP_009871778.1.4187 WP_009871778.1.4264 WP_009871778.1.42718 WP_009871778.1.42889 WP_009871778.1.43504 WP_009871778.1.44223 WP_009871778.1.45552 WP_009871778.1.48551 WP_009871778.1.48923 WP_009871778.1.4939 WP_009871778.1.49465 WP_009871778.1.5036 WP_009871778.1.51159 WP_009871778.1.51530 WP_009871778.1.52091 WP_009871778.1.53299 WP_009871778.1.5416 WP_009871778.1.55117 WP_009871778.1.57520 WP_009871778.1.57533 WP_009871778.1.58046 WP_009871778.1.58308 WP_009871778.1.5967 WP_009871778.1.60427 WP_009871778.1.60937 WP_009871778.1.61004 WP_009871778.1.6151 WP_009871778.1.61683 WP_009871778.1.62239 WP_009871778.1.62489 WP_009871778.1.62510 WP_009871778.1.62968 WP_009871778.1.64162 WP_009871778.1.65182 WP_009871778.1.65391 WP_009871778.1.66489 WP_009871778.1.67104 WP_009871778.1.67250 WP_009871778.1.69355 WP_009871778.1.69519 WP_009871778.1.69991 WP_009871778.1.71307 WP_009871778.1.71619 WP_009871778.1.71686 WP_009871778.1.72034 WP_009871778.1.72164 WP_009871778.1.72442 WP_009871778.1.74323 WP_009871778.1.74635 WP_009871778.1.75470 WP_009871778.1.77153 WP_009871778.1.77651 WP_009871778.1.78375 WP_009871778.1.79775 WP_009871778.1.83525 WP_009871778.1.83642 WP_009871778.1.85256 WP_009871778.1.85365 WP_009871778.1.86066 WP_009871778.1.87079 WP_009871778.1.87298 WP_009871778.1.87666 WP_009871778.1.88177 WP_009871778.1.88937 WP_009871778.1.9107 WP_009871778.1.92427 WP_009871778.1.93216 WP_009871778.1.9343 WP_009871778.1.93600 WP_009871778.1.95142 WP_009871778.1.96955 WP_009871778.1.97423 WP_009871778.1.97602 WP_009871778.1.99598 YP_001654755.1.27483 gi|478457170|ref|YP_007725763.1| gi|527320127|ref|YP_008346327.1| gi|478447259|ref|YP_007715947.1| gi|478467986|ref|YP_007742859.1| gi|389859871|ref|YP_006362111.1| gi|568111680|ref|YP_008921285.1| gi|527328729|ref|YP_008354919.1| gi|478460786|ref|YP_007735737.1| gi|385270118|ref|YP_005813278.1| gi|385244511|ref|YP_005812355.1| gi|478465286|ref|YP_007741968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]