SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375289130|ref|YP_005123671.1| from Corynebacterium pseudotuberculosis 3/99-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375289130|ref|YP_005123671.1|
Domain Number 1 Region: 198-336
Classification Level Classification E-value
Superfamily CBS-domain pair 4.42e-32
Family CBS-domain pair 0.0031
Further Details:      
 
Domain Number 2 Region: 351-415
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.000000845
Family CorC/HlyC domain-like 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|375289130|ref|YP_005123671.1|
Domain Number - Region: 16-140
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0772
Family LacY-like proton/sugar symporter 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375289130|ref|YP_005123671.1|
Sequence length 425
Comment hypothetical protein Cp3995_1566 [Corynebacterium pseudotuberculosis 3/99-5]
Sequence
MTPLICGAATLSALLLSGFLGAVEAAVSSISVARVEQINKDTESRASRTLLHVLENRAEH
INLLILLRTLLDVTAAAFAALLAIDLIESSVWALTAAIVGVSLITFTVIGVFSRTVGRKN
PYTVSLSSAWLLRALSAVLGPIPRLLIKIGNIIAPGPGFQDGPYSTEVELREMVDIAQEH
GVVEVEERRMIQSVFDLASTTARSVMVPRTDMVWIESGKTAGQATSLCVRSGFSRIPVIG
DTVDDIIGVVFLKDLVQRTYYSTDGGRSVTVDEVMRPPTFVPDSKSLDTLLHEMQRDRNH
IAMLVDEFGGIAGLVSIEDILEEIVGEIADEYDDREIAPIERLDSESLPMYRVVSRLSLE
DLTETIEEDLDREIEFSEDIRDQVDTVGGLIAYEMGRVPLPGSVVSTSGIQLRAEGAGTV
GGGSR
Download sequence
Identical sequences gi|375289130|ref|YP_005123671.1| gi|300858948|ref|YP_003783931.1| gi|387137042|ref|YP_005693022.1| gi|386740836|ref|YP_006214016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]