SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352516288|ref|YP_004885605.1| from Tetragenococcus halophilus NBRC 12172

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352516288|ref|YP_004885605.1|
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily YheA/YmcA-like 8.76e-34
Family YheA-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|352516288|ref|YP_004885605.1|
Sequence length 113
Comment hypothetical protein TEH_01140 [Tetragenococcus halophilus NBRC 12172]
Sequence
MANIYDTANQLEREIRELEQFQDLSGSFAELKKNEEAYRLFKEFQTFQQELQEKMSQGED
MTDEDAQRAQELAQQVQQEPLINDLMQKEQVFSTTINDLNRIIMTPLRELYES
Download sequence
Identical sequences A0A1B3J1S5 A0A2H6CE61 A0A2H6CNY8 G4L3X5
WP_014123512.1.16232 WP_014123512.1.37938 WP_014123512.1.76006 gi|352516288|ref|YP_004885605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]