SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352517692|ref|YP_004887009.1| from Tetragenococcus halophilus NBRC 12172

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352517692|ref|YP_004887009.1|
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.31e-23
Family YmcA-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|352517692|ref|YP_004887009.1|
Sequence length 141
Comment hypothetical protein TEH_15180 [Tetragenococcus halophilus NBRC 12172]
Sequence
MIYDEQLFAIEDQMDDLCEVLVKSATFQNYLRQKGLMYEDKNVRVLRDDFIAKKEDFETV
AAYGKYAPDYRKKQLALRKAKRTLDLHPKVAEFRLAETDLQSVLDTIGSKVASTVSEGVK
VDAGTPFFENNLGKGGNCDGG
Download sequence
Identical sequences A0A1B3J4B6 A0A2H6C8Y9 A0A2H6CFG1 G4L8H1
gi|352517692|ref|YP_004887009.1| WP_014124894.1.16232 WP_014124894.1.37938 WP_014124894.1.76006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]