SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352518375|ref|YP_004887692.1| from Tetragenococcus halophilus NBRC 12172

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352518375|ref|YP_004887692.1|
Domain Number 1 Region: 9-118
Classification Level Classification E-value
Superfamily YheA/YmcA-like 2.35e-20
Family YmcA-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|352518375|ref|YP_004887692.1|
Sequence length 128
Comment hypothetical protein TEH_22010 [Tetragenococcus halophilus NBRC 12172]
Sequence
MDPLNKEPEIQAALEQLVDLLAEHDSIQEFQKVQQRALQNEKLQTLEEQIKQVQKAAVQF
AHYDKPEAKKQANAEIDRLKKEYEDQPLVISYRQKLLDANEILHYITDNFEKRVNDAIEE
EDLNASKD
Download sequence
Identical sequences A0A2H6D2I7 G4L349
gi|352518375|ref|YP_004887692.1| WP_014125562.1.37938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]