SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB05G28010.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB05G28010.1
Domain Number 1 Region: 129-225
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-23
Family B3 DNA binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB05G28010.1
Sequence length 277
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:5:15390409:15395157:-1 gene:OB05G28010 transcript:OB05G28010.1 description:"Uncharacterized protein "
Sequence
MAAEAGSAASGAAYEEERRKRVLENLKQLEDLGITKMSKSLLQAARLQKSTRASPKQRRK
FEATEVRRSSRARNSVSYKDDDFGELDSFLRRRRGSRNTEQGRDYTGRIASYEQQQSAFK
RAERLQNRLDPENPSFVKTMVRSHVSSCFWLGLPSRFCKLHLPPREFKMVLEDEEGGEFD
SVYIGNRTGLSGGWRGFAMHHNLEDCDSLVFELVEPDRFKIYIRKAYDEDADESESVDLE
ADGDKKDASAKDATEQNDSPNAESLKGAKRRKLRARR
Download sequence
Identical sequences J3M877
XP_006654551.1.55871 OB05G28010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]