SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB06G10550.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB06G10550.1
Domain Number 1 Region: 32-134
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.55e-28
Family B3 DNA binding domain 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB06G10550.1
Sequence length 199
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:6:316569:317168:-1 gene:OB06G10550 transcript:OB06G10550.1 description:"Uncharacterized protein "
Sequence
MAMTTTMVAWESRRDQLQGGGGGGHGHGGERREHMFEKVVTPSDVGKLNRLVVPKHYAEK
YFPLGAAARSSPAGTVLCFEDARRGGGETWRFRYSYWSSSQSYVITKGWSRFVRDKRLVA
GDTVSFCRAGGRLFIDCRRRAAVPPTTSSLAPQAASINVQRSSAVDEKEAAAGCGGRCLR
LFGVDLQLLAEPPALDLQL
Download sequence
Identical sequences J3MAL1
OB06G10550.1 XP_006656550.2.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]