SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB01G25700.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB01G25700.1
Domain Number 1 Region: 22-160,257-351
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.01e-43
Family Calcium ATPase, transmembrane domain M 0.0059
Further Details:      
 
Domain Number 2 Region: 160-257
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.96e-28
Family Calcium ATPase, transduction domain A 0.00062
Further Details:      
 
Domain Number 3 Region: 345-428,471-525
Classification Level Classification E-value
Superfamily HAD-like 0.000000000000288
Family Meta-cation ATPase, catalytic domain P 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB01G25700.1
Sequence length 581
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:1:11830465:11832655:1 gene:OB01G25700 transcript:OB01G25700.1 description:"Uncharacterized protein "
Sequence
MEMVMETVTAGGLKQIRNEAVNLENIPLANVFVHLKCTEKGLTTDEGNERAAVFGPNKLE
EKKVRLFFPFFGVDLMGVLSDLGVESRILKFLGFMWNPLSWVMEVAAIMAIALANGGNRP
PDWQDFVGIVVLLLLNSSISYFEESNAGSAAEALMANLAPKTKVLRDGRWAEEDAAILVP
GDIISVKLGDIVPADARLLQGDPLKVDQSALTGESLPVTKCPGESVYSGSTCKQGEINAV
VIATGVHTFFGKAAHLVDSTNQVGHFQKVLRAIGNFCIAAIAIGMVIEVIVMYPIQHRLY
RDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAITKRMTAIEEMAAMTVLCSDK
TGTLTLNKLGVDKDFIEVFADGVGKEDVILLAARASRVENQDAIDTTMVGMLDDPKDARR
GIEEILSLCNCIDDMKKRAHAVIDKYADRGLRSLAVARQELPEKNKESPGGKWEFVGLLP
LLDPPRHDSAETIKRALHLGVNVKMITGDQLAIAKETGRRLGMGVNMYPSSALLGHGMND
SIAPVPIDKLIEKADGFAGVFPGMCSHGHGWRAFTPWRFLV
Download sequence
Identical sequences J3L014
OB01G25700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]