SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB02G13010.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB02G13010.1
Domain Number 1 Region: 131-271
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-41
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 1019-1081
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000363
Family PB1 domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB02G13010.1
Sequence length 1135
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:2:1712537:1721086:-1 gene:OB02G13010 transcript:OB02G13010.1 description:"Uncharacterized protein "
Sequence
MATTKQTPASSTATAAASAVPPRGPCEGERKSPAINSELWHACAGPLVSLPPVGSLVVYF
PQGHSEQVAASMQKDVDAHVPSYPNLPSKLICLLHGVILHADPDTDEVYAQMTLQPVNTY
GKEALQLSELALKQARPQMEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQ
ELQARDIHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVIVVRDEKHQLLLGI
RRANRQPTNISSSVLSSDSMHIGVLAAAAHAAANSSPFTIFYNPRASPTEFVIPFAKYQK
ALYSNQISLGMRFRMMFETEELGTRRYMGTITGISDLDPVRWKNSQWRNLQVGWDESAAG
ERRNRVSIWEIEPVAAPFFLCPQPYFGVKRPRQLDDESEMENLFKRAMPWLGEEVCIKDA
QNQNTTAPGLSLVQWMNMNRQQSSSLANTAAQSEYLQALGNPAMQNLAADDLARQLYVQN
NLLQQNCIQFNSPKLPQQMQTMNDLSKAAIPLNQLGAIINPQDQKQDAVSHQRQQNSIQV
IPLSQAQSNLVQAQVIVQNQMQQQKPSPAQNQQRINSQSLLLPHQQQDQNLQLQQQLLLQ
QKQQLQQQQQQQHNQQQLNKSLGQLVNLASQQSKLFDEELQLQILQKLQQQSLMAQSTAT
LSQPPLIQEQQKLLIDMQKQLSNSHPLAQQQMIPQQESKPLLQATPLLPTVQQEQQQKLL
QKQVSLADVSEVAFQPISSTNVIPKTGGAMIISGAAQSVVTEEMPSCSTSPSTANGNHLA
QSTKNRHCINTERLPPSTAPMLIPTSIDAVTATPTMTKELPKLNNNVKQSVVNSKLPNVV
PGPQNCMNNSLQTDNLETSSSATSLCPSRTDGLMHQGFPSSNFNQHQMFKDTLPDVQIEG
VDPTTSGLFGINNDNPLGFPIETEDLLINALDSVKYPNHISTDVENNYPMQKDALQEIST
SMVSQSFGQSDMAFNSIDSAINDGAFLNKNSWHTAPPLQRMRTFTKVYKRGAVGRSIDIG
RYSGYEELKHALARMFGIEGQLEDRQRIGWKLVYKDHEDDILLLGDDPWEEFVNCVRCIR
ILSPQEVQQMSLDGDLGSNVLPNQACSSSDGVNGWRPRCDQNSGNPSIGPYDQFE
Download sequence
Identical sequences J3L9I4
OB02G13010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]