SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB02G14110.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB02G14110.1
Domain Number 1 Region: 2484-2772
Classification Level Classification E-value
Superfamily BEACH domain 9.81e-123
Family BEACH domain 0.0000000118
Further Details:      
 
Domain Number 2 Region: 2872-3136
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.14e-38
Family WD40-repeat 0.0093
Further Details:      
 
Domain Number 3 Region: 2312-2354,2396-2460
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-19
Family PreBEACH PH-like domain 0.0062
Further Details:      
 
Domain Number 4 Region: 999-1187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.43e-18
Family Pentraxin (pentaxin) 0.084
Further Details:      
 
Weak hits

Sequence:  OB02G14110.1
Domain Number - Region: 1449-1562,1648-1697
Classification Level Classification E-value
Superfamily ARM repeat 0.00288
Family Pumilio repeat 0.096
Further Details:      
 
Domain Number - Region: 697-969
Classification Level Classification E-value
Superfamily ARM repeat 0.00403
Family B56-like 0.085
Further Details:      
 
Domain Number - Region: 230-351
Classification Level Classification E-value
Superfamily ARM repeat 0.0595
Family HspBP1 domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB02G14110.1
Sequence length 3152
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:2:2395161:2415768:-1 gene:OB02G14110 transcript:OB02G14110.1 description:"Uncharacterized protein "
Sequence
MLWQKYENAIDKAEKKETLQIFVMHFIQTFKEWEPYYIAQSVDQESLSDDMVLGCSSGHP
SEVILILVQEVSQITSFITEIGSSCSEFSPNISEQSSVLVLSTEGLTVLECLTIVTRSVH
NCRVFSYYGGVQKVTALLKAAVVKLKTLTSLLAADEQLPNKAIENMKMMQKILVYIVTII
SNFMNLEPTVTRLMQLVNTTEHTLSNEFLATITPRPAKSTNDNNWQQKAIVAVMEAGGVN
WLVELLRVIRRLNLKEQWTDLLLHFITLHALRSTICQNTRAQNHFRSIGGLEVLLDGLGL
PSSKLSKCSFVPSDERSGILQLQILSLEILREAVFGNVNNLQFLCENGRIHKFANSICWP
AFMLQGFHQQKTLDSQVQNCNLEESTGALSTSESFASPIDILDTTGWTEYSVKLSIALCS
FLLPPNEIRNSRGAADVSQNSQSVSLAYWEQCTRWIIKVLSTVFPCIKACASESEFPDHI
RILANTLQHYILCTFRKVLILVPALLKSFRAEGLWGLIFSEKFFYFGSSMEYIHHIVGDA
QNDHFIDATDSAGSKAQADVNILQAEAISFLEFAATLNENTNNLPECSALLDVLEHCTYD
PGLSGTILKSFHVILQLATEQTISSFKSLDVLTRVLKVACLQVQHLRKLSHPRDYLSGNV
FQSEYEQIKSTIACVELAFNLFKEYATISELGMILVLHNANCIECLFDLFQEENLRKDVL
EQVLALFRLPSSSAQDHTAKLQLCSKYLEAFTRAKETDDFAELSIDLLVNMRAIIMIDRM
YYQNLFHNGECFLHIVSLLNGTFDEAVGEQLVLNVLQTLTVLLAENDVSKASFRMLVGVG
YQTLQSLLLDFCKWLPSQKLLDAILGMLVDGTFDINEETTIKNEDVIILFLNVLQKSSTT
LQHYGLAVLQQLLKGSITNRSSCFKAGFLSFLLDWFSVEQTDDTVVKIVELIQIIGGHSI
CGKDIRKIFALLRDEKIGVKQKHNSLLLTSLSHMLKEKGPEAFFEFSGHDSGIEIKSPAQ
WPYNRGLSFCCWLRVESFPENSMMGLFSFFTENGKGCLAMLGKDTLIYESISQKHQCVLL
PLSLPTKQWIFLSVTHTVGRAFSAGSQLRCYVDGGQISNQKCRWAKVNEVMTRCSIGTDL
MPIGEEPTSLGFESTSAFVGQMGPVYAFSDTLSSEQIKGIYNLGPSYMYSFLGDQNLLMS
DDTLYKGILDARDGISSKMIFGLNAQASNNRTLFNVSAAYDGLDKSKFEATIMGGTKLCS
RRLLQEIIYCVGGVSVFFPLLIHFDDAVVHSGQPAISDELASQVVELVASVLDGNVANQQ
QMHLLSGFSILGFLFQSVSPQLLNFKTLSSLKYMLNVLKNCGMSEILLKDALSQIYLNPH
IWACASYEVQRELYLLLIKYFECDGTLLPILCGLPRIIDIVLQFYSEKADLRSCKSSHPV
TKNVIVERPNIEEIRKIRLLLLSMAEMSIKLKVSQHDIRTLVSFFERSQDVACIEDVLYM
IIRALSQNSLLSSFLEKVNSLGGCYIFINLLKREFEPIRLLGLQFLGKLLVGVPSEKKGP
KLFGLPVGRPRPLSENLSKAITAAPQLFFYSISERLFKFPLSDHLCATLFDVLLGGASPK
QVLQKRSQSDVPKDSAISSASVSPFAVPQILVCIFKYMQSCQDTLARTKILSDLLDLLDS
NPSNVEALVEYGWSSWLETSVKLDVFRDYKSSSKAKDNTLETNELILVRNMYSLVLTYCL
CSVKGGWHQLEDTTNFFLLKIEQGQLPNSCVLRDIFEDIVGSLLETSSEENLFFSQPCRD
NILYLLKLSHELLVDQVGIKLLFPSPGLSAQSSSDDSLIEDINIAVGEILNAEGSSQLTS
FPWSNSPSTDGDKLSDDWWSFYDKIWTLLCNLTGKGQNKLTPKGSNAAVPSIGQRARGLV
ESLNIPAAEMAAVVVTGGIGSALSGKTNKNTDKAMMLRGERFPRIMFHLIILYLCKAGLE
NASKCVQQFTSVLPNLISEDDQCKNRLHLLIWSLLRVRSQYGELDDGARSHVMSPLIFET
LIHGKSLLATPMLARDDSTEANSNKDSGFVLNFVQKDRVLAAVADEVKYVKDAKADHLRQ
LQELHSKIDESLIEDIEQLQSFEDDIQFAKTAAISVDDSRKAALQLAFDEDQQIIADKWI
HIFRALSEERGPWSANPFPNSTVTYWKLDKTEDKWRRRLKLKRNYKFDERLCQPPSKSSS
ESNASSVDPSVGTKIPEKMKHLLLKGVRGITSDVSSEPCEDSNDMSEPSQNTLSETQGSS
DAAESTDSSDYSNIVQNRKEPVSAGGDDDYAEVLSSVQCVLVTPKRKLAGQLTITRNALH
FSFEFLVEGTGGTSVFNRYKEKNDSNSKNDLGGAEKLKSNLDGGRVNATESGDALMKNTS
NKIKHHRRWKISRIKAVHWTRYLLQYTATEIFFDDANAPVFLNFSSQNDAKNIGSLLVSL
RNDALFPKGSSKDKSSVISFVDRKVALEMAESARESWRRREMSNFEYLMILNTLAGRSYN
DLTQYPIFPWILADYSSDKIDFNKSSSFRDLSKPVGALDTKRFKVFEERYLNFCDPDIPS
FYYGSHYSSMGIVLYYLLRLEPFTALHRNLQGGKFDHADRLFQSIESTYRNCLSNTSDVK
ELIPEFFYMPEFLENSNSYHLGVKQDGEPLGNVGLPPWAKCSPEEFIHINREALESEYVS
SNLHHWIDLIFGYKQRGKPAVEAANIFYYLTYEGAVDLENMDDMLQKSAIEDQIANFGQT
PIQIFRKKHPRRGPPIPISHPLYFAPQSITMTSVTNSSSSSVLFVSLLDSNIVLMNEGLI
LSVKLWLTTQLQSGGNLTFSGSLEPFFGIGSDVISPRKISTSLAENVNFGRQCLAAVQIH
SDNYLILCGNWENSFQIISLGDGRIVQSIRQHKDVVSCVAVSSDGSVIATGSYDTTVMIW
HAFRGKSADKKSRNANYDQSTKDHVIIESPCHILCGHDDIITCLFVSTELDIVISGSKDG
TCIFHTLREGTYVRSIRHPSGAGLSKLVASQHGRLIFYSDSDLSLHMYSINGKHIASSEA
NGRLNCMELSCCGEFVVCAGDHGHIVLRSMHSLDVVWRYEGAGKTITSLVVTPEECFLAG
TKDGSLIVFSIENPLLRKGTVQRNKIKSSTSG
Download sequence
Identical sequences J3L9U4
OB02G14110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]