SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB02G28170.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB02G28170.1
Domain Number 1 Region: 115-254
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.62e-44
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 546-624
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000687
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB02G28170.1
Sequence length 674
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:2:15216428:15222045:1 gene:OB02G28170 transcript:OB02G28170.1 description:"Uncharacterized protein "
Sequence
MASSGAAAAGGGTGNSCDALYRELWHACAGPLVTVPRRGELVYYFPQGHMEQLEASTDQQ
LDQHLPMFNLPSKILCKVVNVELRAETDSDEVYAQIMLHPESDQNEPTKPQPDPHEPEKC
NVHSFCKTLTASDTSTHGGFSVLRRHAEECLPPLDMTQNPPWQELVARDLHGNEWHFRHI
FRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRLMRQLNNMPSSVISS
HSMHLGVLATASHAISTGTLFSVFYKPRTSQSEFVVSLNKYLEAKNSKISVGMRFKMRFE
GDEAPERRFSGTIIGVGSMPTSPWANSDWRSLKVQWDEPSVVPRPDRVSPWELEPLAVSN
TQPLPQPPARNKRARPPASNSIAPELPPVFGLWKSPAESTQGFSFSGLQRTHELYPSSPN
SIFSTSLNVGFSTKNESSALTNKHFYWPMRETRADSYSVSINKVPSEKKREPSSAGCRLF
GIEIGSAVEATSPVPAVSGVGQDQPAASVDAESDQLSQPSHANKSDAPAASSEPSPHETQ
SRPVRSCTKVIMQGMAVGRAVDLTRLHGYDDLRCKLEEMFDIQGELAASLKKWKVVYTDD
EDDMMLVGDDPWPEFCSMVKRIYIYTYEEAKQLIPKSKLPIIGDAKQNPNKQSPESDMPH
SDLDSTTPVTDKDC
Download sequence
Identical sequences J3LDV0
XP_006648743.1.55871 OB02G28170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]