SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB03G14060.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB03G14060.1
Domain Number 1 Region: 18-78,113-207
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.14e-26
Family N-acetyl transferase, NAT 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OB03G14060.1
Sequence length 226
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:3:2430605:2431285:-1 gene:OB03G14060 transcript:OB03G14060.1 description:"Uncharacterized protein "
Sequence
MTTPANSTAFSGEVWAELRLADASDVPHIHALIHQMAEFELLTDLFAATHELLTSTLFPS
PPRPPLPSFTALILVLSPSPLPAAADSTIGSCRLDLSASPLADPEAAAFASPRGGGRVTA
GFVICFPNYSTFLSKPGLYVEDIFVRAPWRRRGLGRMMLSAVAGKAAELGMGRVEWCVLD
WNKNAIDFYEGMGAEVLPQWRICRLTGAALDKYKGGQEESGKAAAE
Download sequence
Identical sequences J3LK30
OB03G14060.1 XP_006649412.1.55871 XP_015690898.1.55871 XP_015690899.1.55871 XP_015690900.1.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]