SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB03G25620.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB03G25620.1
Domain Number 1 Region: 80-169,310-446
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.35e-24
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 
Domain Number 2 Region: 165-236,268-306
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.44e-18
Family Calcium ATPase, transduction domain A 0.0062
Further Details:      
 
Domain Number 3 Region: 439-475
Classification Level Classification E-value
Superfamily HAD-like 0.0000146
Family Meta-cation ATPase, catalytic domain P 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OB03G25620.1
Sequence length 648
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:3:10506532:10512800:-1 gene:OB03G25620 transcript:OB03G25620.1 description:"Uncharacterized protein "
Sequence
MDVPTRLPDPVPSPILRHSPSSGSAMSRSLRSLADMPSVTFAADMRRSASERAGSQRDLR
DEDARFVYINDAARTNAPPARFPDNSVRTTKYSILTFIPRNLYEQFHRVAYVYFLILAAL
NQVPQLGVFSPVASVLPLAFVLGVTAVKDAYEDWRRHRSDKNENNRTASVLVDGVFQPKP
WKEIQVGDLVRVVANETLPCDMVLVSTSDPTGVAYVQTINLDGESNLKTRYAKQETMSTP
TEALAGLIKCEKPNRNIYGFLATVDLDGRRAVSLGTSNIMLRGCELKNTAWAIGVAVYTG
RDTKVMLNNSGAPSKRSRLETHTNRETIVLAVVLTILCTLVSLLAGIWLSDHRDKLGVIP
FFRKYDFSDPNEVDNYKWYGRGAEVTFTFMMAVIQFQVMIPIALFISMELVRVGQSYFMV
QDKHMFDDKTQARFQCRALNINEDLGQIKYVFSDKTGTLTENRMEFRCASVHGGDFSETV
GGAADGHAVTDDGVVLRPKTVVKTDPKLMATLRDGTGAKADAARDFFLTLVTCNTIVPII
VDDDEEEAADGDPAAGTGGEGGPADGDPAAARRRRLVEYQGESPDEQALVYAAAAYGYTL
VERTSGHIIIDVFGNRQRVYQHGSEECEARGKQHIRIKLSQMSPNLGP
Download sequence
Identical sequences J3LND6
OB03G25620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]