SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB03G34380.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB03G34380.1
Domain Number 1 Region: 25-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-19
Family B3 DNA binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 193-295
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000255
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OB03G34380.1
Sequence length 298
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:3:19136444:19138462:1 gene:OB03G34380 transcript:OB03G34380.1 description:"Uncharacterized protein "
Sequence
MRRPGARCKEEHAHFNRNHVDGPDMNFFKVMIGHFRERMTIPDEFQQYFRGKIPRTIKLR
SRSGCTFDAEVTKNLSKLSLQSGWKAFATAHDLQMGDFLVFTYEEGISELKFLIFGPSGC
EKVPSCSLHDHSPSNSQTQWGSSKQENNIANIEDAALQGDDFQVHPLPGCIIPKRTRLTD
AQKQQLENKVQAIHSEIPIYGCILRKTSIQGKPQTVDICPEYADVYLPSNKRLNIRLQRH
GKNWDVQCRTNKIGSKRLSKGWICFARDNNLHVGDICLFELLNNKECTTMNVHVIPEK
Download sequence
Identical sequences J3LQW2
OB03G34380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]