SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB03G35210.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB03G35210.1
Domain Number 1 Region: 84-279
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.96e-62
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000117
Further Details:      
 
Domain Number 2 Region: 264-400
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.11e-36
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OB03G35210.1
Sequence length 401
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:3:19995626:19998941:1 gene:OB03G35210 transcript:OB03G35210.1 description:"Uncharacterized protein "
Sequence
MAAATSLHVAAAPVATPRVGFSSSSAAGYRSASAARSVRVAAAAGSGAARAGRRVVARAA
VAAKADSPASAASSKSDGHEVLLFEALREALIEEMKEDPTVCVFGEDVGHYGGSYKVTKG
LAEMFGDLRVLDTPIAENSFTGMGVGAAMKGLRPVVEGMNMGFLLLAYNQISNNCGMLHY
TSGGQFKIPIVIRGPGGVGRQLGAEHSQRLESYFQSIPGLQMVACSTPYNAKGLMKAAIR
SENPVVLFEHVLLYNLKEKIPDEEYVLCLEEAEMVRPGEHVTILTYSRMRYHVMQAAKTL
VNKGYDPEVIDIRSLKPFDLHTIGNSIKKTHRVLIVEECMRTGGIGASLRSAIIDNFWDY
LDAPIMCLSSQDVPTPYAAPLEDATVVQPAQIVAAVEQICQ
Download sequence
Identical sequences J3LR45
OB03G35210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]