SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB03G41060.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB03G41060.1
Domain Number 1 Region: 1054-1111
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000168
Family PHD domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1248-1336
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000255
Family N-acetyl transferase, NAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB03G41060.1
Sequence length 1425
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:3:24936447:24949352:1 gene:OB03G41060 transcript:OB03G41060.1 description:"Uncharacterized protein "
Sequence
MAGVTRVSLRRRACRDGLYCGGGTVAAGGALTWTRMTRGCCVGTGMGHNGSKRSPTRGAE
DGGMKDLEKSTPLEFNEPTSDGDVDLGGGLTVVGRKRKDGRGSVDENGGSTKRIPRSSSM
SLHVDAETAGDLALDVCQGKSLEKKQCDVKAEGDRGGMLTVDSCNAEEDREVTDVIVSDA
VVEEVRCSVNNVESFGLAEVEVAEGNGFGTDILESDVKTEKADDKMSTPSEEQNESGGGT
SVMCINDSQENKGINGPCQGEVIDPSATANGDELSMGLSRSNLTNGQESIEEEDTIVRDS
DDQKIEKHCQVDDVHKESEISPIENGRCTVDNHIMLTDCTNQRKGMDSPVNETKGDSTPD
IVFIRRKSITRKTCEAKQLKSEEEVQFEKRVTRSATVRQREVSSACISATTDANLESKEM
KEDVLHHYTRKAGSTVRSKTHHMEVAECDTNTKKKLKGNVTTRRNSGVTGNGDHASIMHN
KESQTEMKTNLKSQPLTRRGSIVNKTEDAVSGLDHNVCSSAITDKNDVELTDSEGVKSDN
RTTVRKPILSVGAKIVASKKRILESELDKTGGASPVAIPSIKKARDTSSDTKLEQPKKSS
GKKLTRNNRGLDKKGMSTRQQHRSQTAELRTSVNRSNKSERKPSQNESNVDGTDSDTSLK
NTSVRRTRSGGLVPKKQDNSSESEEVIVVRKNRQRVKYSGQIQMSGSIPTHPSGSSRTSH
FDKSALTKSEHRSFSRQAEKEKIKAPKGNRKEDKASSVKSSSPSEQINTGSLREEKQKIS
EHIKGILLNAGWTIDLRPRNGRNYLDSVYIPPSGKGSYWSVTKAYAVFLEDVECEQKGGA
KNQRPSKKSVGSPGKKHLSEEILSKLKRIVVNKRRTKVELLKLKKRRHNLLKNKKYSKGK
SREKKNKISNSRKLNLGSERKKRGGCALRARGSNKEGGSSTNGFVPYEWKRTVLSWLIDL
DIVCVNAKLKCMDETRTDVLLEGIITRDGINCSCCSNVFPVLEFVAHAGGSVSKPYRNLL
VDGMDTDLLHCLINAWDKQSDSERKGFFPISTETDDPNDDTCGICGDGGNLICCDGCPST
FHMNCLELEALPSDDWRCAKCTCKFCQKHPSQDAQDIAEVDSELCTCLQCEEKYHPGCSP
ETTSTSSVSSQAGNFFCQQSCRLLSEGLQNLLAVKKDLESEFSCRIIQCIHEDVPETVIA
LDERVECNSKIAVALSLMDECFLPILDQRTGINLIRNVVYNCGSNFVRMDFRGFYIFTLE
RGDEIIAAASVRIHGTKLAEMPFIGTRNMYRRQGMCRRLLDGIEMILSSLNVEKLIIPAI
AELVDTWTSKFGFSPLDASQKQEVKSINILVFPGTGLLQKPLLKKTSLEEHLGSQEVDGV
SSELKSGIASHVANEDSLCSANDETQGSAVTYYVDSTKDASACND
Download sequence
Identical sequences J3LST0
OB03G41060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]