SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB03G44040.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB03G44040.1
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.07e-27
Family N-acetyl transferase, NAT 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OB03G44040.1
Sequence length 143
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:3:26818487:26819396:1 gene:OB03G44040 transcript:OB03G44040.1 description:"Uncharacterized protein "
Sequence
METVTLRRFELADADAMMAWASDPEVTAFMAWEPSESVEHLRAFIGGTVLPHPWFRAICL
AGPGASPGVATAALKRALATAFADLPGVERVEALVDVDNAASRRALEKAGFHQEAVLRSY
CVVNGRLRDMVIYSFISTDPLVE
Download sequence
Identical sequences J3LTM8
OB03G44040.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]