SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB04G20880.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB04G20880.1
Domain Number 1 Region: 116-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-44
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 547-625
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000226
Family PB1 domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OB04G20880.1
Sequence length 673
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:4:10580321:10585606:1 gene:OB04G20880 transcript:OB04G20880.1 description:"Uncharacterized protein "
Sequence
MAAAMEMAANPGGGSGSCSDALFRELWHACAGPLVTVPKRGERVYYFPQGHMEQLEASTN
QQLDQYLPMFNLPSKILCSVVNVELRAETDSDEVYAQIMLHPEADQSELTSPDPEPQELE
KCTAHSFCKTLTASDTSTHGGFSVLRRHAEECLPQLDMSQNPPCQELVAKDLHGTEWHFR
HIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRDENGELRVGVRRLMRQVNNMPSSVI
SSHSMHLGVLATASHAISTRTLFSVFYKPRTSRSEFVVSVNKYLEAKKQNLSVGMRFKMR
FEGDEAPERRFSGTIIGIGSVPAMSTSPWADSDWKSLKVQWDEPSSIVRPDRISPWELEP
LDTTNPQPPQPPLRNKRARPPASPSVVSELLPSFGLWKSPSEAAQTLSFSEPHRTREIFP
SIPASIFSASSNAEFNSKKEPSMLNNQFYWSARDSRADSFAASTNKVRVERKQEPTTVGC
RLFGIEISSAVELLPAATVSGVGYDQTVVSGDVDSDQISQPSNGNKSDAPVTSSEHSPLE
SLSRQVRSCTKVIMQGMAVGRAVDLTKLGNYGDLRRKCEEMFDIQGELCPSLKRWQIVYT
DDENDMMLVGDDPWDEFCSMVKRIYIYSYEEANLLAPKSKLPNIGDTIQFSGVNSSPESV
GLDSHASVTNKDC
Download sequence
Identical sequences J3LY63
OB04G20880.1 XP_006653437.1.55871 XP_015692249.1.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]