SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB04G28210.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB04G28210.1
Domain Number 1 Region: 2150-2436
Classification Level Classification E-value
Superfamily BEACH domain 5.49e-126
Family BEACH domain 0.00000000954
Further Details:      
 
Domain Number 2 Region: 2558-2627,2667-2782,2821-2868
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.42e-29
Family WD40-repeat 0.0081
Further Details:      
 
Domain Number 3 Region: 2024-2135
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-22
Family PreBEACH PH-like domain 0.0016
Further Details:      
 
Domain Number 4 Region: 278-317,362-503
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000127
Family Clostridium neurotoxins, the second last domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OB04G28210.1
Sequence length 2894
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:4:15284023:15304487:-1 gene:OB04G28210 transcript:OB04G28210.1 description:"Uncharacterized protein "
Sequence
MAEDPRESLDPSPEPPRGQDSEEELSAGPPADEARAEERELELDPGMSTGTPVAVTPTRS
EPSPPPPRRRRPRTLGVPSDAPQEVVRAVDDAIMVGGGAAGGVDRLREMVSEEQGELPHT
VVDVLLGTMGGADGLDEVEDKTGTGAPPSIMFNSRAAVVAAELLPYLPCGEEPSPRTRIA
VGIHATLRACTRNRAMCSSSGLLPILLESAEKLLIGTGRTSSWDGTPLLHCIQLLGGHSL
SVKDLHSWLGLVKKALGTSWATPLMLALEKAMGSEETRGPAATFEFDGESSGLLGPGDSR
WPFSNGYGFATWIYIESFSDTLSTATAAAAIAAAAAATSGKSSAMSAAAAASALAGEGTT
HMPRLFSFLSSDNQGVEAYFHGQFLVVESGGVRGKKASLHFTYAFKPQRWYFVGLEHTNK
HGLLGKGDSELRLYVDGNLYESRPFEFPRISKPLAFCCIGTNPPPTIAGLQRRRRQCPLF
AEMGPIYIFREPIGQERMGRLASRGGDVLPSFGNGAGSPWRATNDHVKNMAEESFSLNQQ
IGGCLHLLYHPSLLNGRFCPDASPPGSAGTHRRPAEVLGLVHVSSRVRPAESLWALASGG
PMALLPLTISNVQLDSLEPMLGELSLGTASLSVPIFRIISLAIQHPGNNEELCRTCAPEI
LSRVLHYQLQAFPKMESREREAVTGEELVDAIVSLCQSQRNNHDLKVQLFSTLLLDLKMW
ISCTYGLQKKLLSSLADMIFTESACMRDANALQMLLDGCRRCYWAIREPNSIDNLALTET
KRSLGEINALIDELLVVVELLLGSASSTAASDDVRCLIGFVVDCPQPNQVARVLHLIYRL
IVQPNVSRANMFAQSFISSGGVEALLVLLQREAKAGNNRTLDNSDAPLSENDVERNDDSD
TKAASGEAKSQDDQIQSVEQHASILHEEHTELEATSTSDVPCEILGSSIGRKLSSSENQL
LKNLGGINFSITADNVRNNVYNVDKGDGIVVGIIHIMGALVASGHLKFASSAANPNLPGG
LLTTVHEEGNTMSEDRVSLLLFALQKAFQAAPRRLMTVNVYMALISAAINVSSVDENLNL
YDCGHRFEYIQLLLVLLRSLPYASRSFQSRAIQDLLFLACSHPENRTTMTSIAEWPEWIL
EVLIYNHEMGAKKNADGISIGDIEDLIHNFLIIMLEHSMRQKDGWKDVEATIHCAEWLSM
VGGSSTGGQRIRREESLPILKRRLLGGLLDFSARELQVQTEVIAAAAAGVAAEGLSPEEA
KTQAENAAHLSVALAENAIVILMLVEDHLRSQGQQFCTASSIDSAVASASIASSASSRSN
SLCRSGNEPTDAGTTRRSSLSTDAGGLPLDVLTSMADSNGQISAAVMERLTAAAAAEPYE
SVRHAFVSYGSCIADLADSWKYRSRLWYGVGIPSKLDTFGGGGIGWEFWKSVLEKDSNGT
WVELPLVKKSVAVLQALLLDDSGLGGGLGIGGGSGPGMGVMTALYQLLDSDQPFLCMLRM
TLVSMREDDNGEGDAFTSNISIKDVISEGLGHQAGSMTPFDSNNRSSTRKPRSALLWSVL
GPILNMPINESKRQRVLVASSILYSEVWHAIGRDRSPLRKQYIELILPPFIAILRRWRPL
LAGIHELTSSDGQNPLIADDRALAADALPIEAALSMVSPGWAAAFASPPVALALAMMAAG
ASGTETVTPPRNTLNRRDTSVPERKAASKLQSFSSFQKPIETAPNKPGSTAKDKAAVKAA
ALAATRDLERTAKIGSGRGLSAVAMATSGQRRSAGDIERAKRWNTSEAMSAAWMECLQSV
DSKSVSGRDFSALSYKYVAILVAGFALARNLQRVEMERQTQADVLNRHRVSTGVRAWRHL
LHCLTEMDRLYGPFGDPLCTPDRTFWKLDFTESSSRMRRFMKRNHKGSDHLGAAADYEER
KLISNAVQSNECNPEGAEPSLTGALPSTAPIITAEAMSVDDRNEDNEQLESDTTQSSVDD
RFQQADQHSVKGSVDSRGSGISADRNLVRSTVIAPGYVPSDADERIIVELPSLMVRPLKV
VRGTFQVTSKRINFIIDESASESNMDDHASTSGQYDQQDKDRSWLISSLHQIYSRRYLLR
RSALELFMVDRSNFFFDFGDMEARKNAYRAIVHTKPPNLNDIFLATQRAEQILKRTQLTE
RWANWEISNFEYLMELNTLAGRSYNDITQYPVFPWIIADYRSEMLNLDDPSTYRDLSKPI
GALNPERLEKFQERYSTFEDPIIPKFHYGSHYSSAGTVLYYLFRVEPYTTLAIQLQGGKF
DHADRMFSDLSGTWDSVLEDMSDVKELVPEMFYLPEVFTNINSIDFGTTQLGGKLDSVDL
PPWAEDPVDFVHKHRKALESEHVSAHLHEWIDLIFGFKQRGKEAVMANNVFFYITYEGTV
DIDKITDPVQRRAMQDQIAYFGQTPSQLLTIPHMRRKPLAEVLHLQTIFRNPSELKSYLL
PNPDRCNVPASTMFVSNDSIVVVDANVPAAHVALHQWQPNTPDGQGTPFLFHHGRNAANS
TSGALMRIFKGSSNSGEDCDFPRAIAFAASGICSSAVVAVTCDKEIITGGHADGSVKLIS
PEGAKTIETASGHVAPVTCLALSHDSNYLVTGSRDTTVILWRIHQTSSLHKKNAPEPPPP
TPTTPRSPHSSSTSASNLTEMRRRRIEGPMHVLRGHLEEVTSCSVSPDLGLVVSSSSMSG
VLLHSLRTGRLIRKLNVAEAHSVCLSSQGVILVWNESKKRLSTFTVNGLPIATSVLSPFC
GRVSCIEISTDGHFALMGTCSSSNYKCEGNNETGHHEPSEQNGRDSISKQAETEQSVHVP
SICFVDLHKLKVFHTMELGMGQDVTAIALNKENTNLLVSTADKQLIVFTDPALSLKVVDQ
MLRLGWEGDGLLQS
Download sequence
Identical sequences J3M096
OB04G28210.1 XP_006653659.1.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]