SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB05G11050.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB05G11050.1
Domain Number 1 Region: 261-354
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.22e-22
Family Canonical RBD 0.0017
Further Details:      
 
Domain Number 2 Region: 162-256
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-20
Family Canonical RBD 0.0028
Further Details:      
 
Domain Number 3 Region: 360-427
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000817
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Domain Number 4 Region: 452-490
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000454
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 5 Region: 522-548
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000419
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OB05G11050.1
Sequence length 549
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:5:587949:591120:-1 gene:OB05G11050 transcript:OB05G11050.1 description:"Uncharacterized protein "
Sequence
MVLARKKLKQKLRKVVPGGDAEAVAEVGSPEDGLVSSKSKRPRPKRPKKVKEPVQRRKRQ
SEEQFRREVDLRREERRKEKKEKRRIRRLMEAAAAAGKVQVEPECEEAEAEGEEEAAVAE
GEQAPGPDGATKAKNQKVVEKRKPKVKNQELQQVGDHAVRSDDPFLAQESEENAKKVYVG
GIPYYSSEDDIRSFFEACGSITALDCMTFPKSGKFRGIAILTFKTDAAAHRALALDGADM
GGFYLKIQPYKSNREKEDFAPKMIEGYNRVYVGNLAWDITEDDLKRFFSDCKISSIRFGI
DKETGDFKGYAHVDFSDGTSLAVAMKLDQMAIKGRPVRIRCAVPKKDNQKLNGNANPDSS
KNKIRTCYECGAPGHISSFCPNKSASEAISDGKKANVDSATLSSKKRRTCYECGIPGHLS
SACPNKKAEDAVSIDKGADDETKSAPSITPEENKIGEESNSATSKKRRKCYECGSPGHLS
SACPNKVAVVNSDMEKPYEGSSAVPSAPSDGNKASDDSKSVPAKKKKRRTCYVCGIAGHL
SSECPNKTT
Download sequence
Identical sequences J3M3D1
OB05G11050.1 XP_006653974.1.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]