SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB06G10870.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB06G10870.1
Domain Number 1 Region: 16-569
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.14e-101
Family Acetyl-CoA synthetase-like 0.0000117
Further Details:      
 
Domain Number 2 Region: 798-1100
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.22e-36
Family Quinoprotein alcohol dehydrogenase-like 0.0074
Further Details:      
 
Domain Number 3 Region: 585-648
Classification Level Classification E-value
Superfamily ACP-like 0.00000468
Family Peptidyl carrier domain 0.017
Further Details:      
 
Weak hits

Sequence:  OB06G10870.1
Domain Number - Region: 1129-1156
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0196
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB06G10870.1
Sequence length 1159
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:6:534573:544536:-1 gene:OB06G10870 transcript:OB06G10870.1 description:"Uncharacterized protein "
Sequence
MAVEAAAAAVVPGMEEPCCISHAFDRAVRQKPTRVAIIHAASSGSDSDRRFTCADLLAAV
STLSRRIAAELRSSASRHRDESPDCSESDRPTKAPRIVGVYASPSVEYIAAVLAVLRCGE
AFLPLDPSWPEERIRWATSVSNAALVVSAGGLGAAHVFASSAFSVIRMDGDLWQGSEDGK
DVIGREELAWPCECDRPRDFCYVMFTSGSTGKPKGVCGTERGLLNRFSWMQRWKPLCSDD
VLLFKTSVSFVDHLQEFLSAMLTCTTLVIPPPNDWRANPAFLANLIKAYGISRMTLVPSL
MEIILPTLEKNLSWTHNPLKILIFSGEILSIFLWRRVHRILPETTIVNLYGMTEVSGDCT
FFDCTDLPAILKREELTSVPIGFPISNCEVCIATDARIADEGEMHVSGACLFAGYLEESM
MTNHSQGSGSSTYYRTGDFARRLKSGEFIFLGRKDRTVKLYGQRFSLHEVESTLKEHPAV
SAAAVTFQNNGNNGSVDFRAYLVLKNSAASAEDCQQRKKHKSSQVIMPSMRSWLVMKLSP
AMIPRFFHPVESLPLTSSGKIDYLKLSSLNCASESHEIETERNTVNPHLQLIKEAFCDAL
LVDEVSDFDDFFTLGGNSISAAHVAHKLEIDMRVLYIYSTPSKLLDALFMKHGCLLSSGH
EPRPKKGLDTSSSIPSSFNPISTSVNDSFPEGKSHLNGDGECAHDKITGNFANEVDDQLN
KNMPLSNDRYQMKPPKSPVLDKCSNDRNCLDDSPWILNFHLQKKWSLGRCNRFMHGYEGK
LQLEDVCAYVPYSERGYLQAIWNIPLGSCVDASPLLVSNDGMLNIFIGSHSHSFLCIDGC
SGSVRWCVKLEGRIECSATITGDFSEVVVGCYKGKIYFLDMLTGKLAWTIQTDGEVKMQP
VVDRIRNLIWCGSYDHHLYALNYKDRCCAYKISCGGSIYGSPAIDMTHNVIYVASTSGLV
TAISLEVSSFRIIWQYEAGAPIFGSIAIHHQSGNVICCLVNGLVIALNSHGSVAWKATVG
GPIFAGACLSSGLPSQVLIPSRDGRLYSFDTTSGALLWEYEVGDPITASAFVDEVLTSTS
SGSSERFACICTSSGRVHVIRIRVDAKQEKVNGSVCSDLVQGIAAIDLPGDIFSSPLMVG
GRIFVGCRDGQLHCLTISS
Download sequence
Identical sequences J3MAP3
OB06G10870.1 XP_006655708.2.55871 XP_015694049.1.55871 XP_015694050.1.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]