SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB06G30170.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB06G30170.1
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.28e-27
Family N-terminal domain of MutM-like DNA repair proteins 0.0018
Further Details:      
 
Domain Number 2 Region: 146-230
Classification Level Classification E-value
Superfamily S13-like H2TH domain 5.1e-23
Family Middle domain of MutM-like DNA repair proteins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OB06G30170.1
Sequence length 398
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:6:17745580:17748491:-1 gene:OB06G30170 transcript:OB06G30170.1 description:"Uncharacterized protein "
Sequence
MPELPEVEAARRALEAHCVGRRIARCAVADDAKVVVGVTRVAFERAMVGRTIVAARRRGK
NLWLRLDAPPFPSFQFGMAGAIYIKGVPVTQYKRSVVSSTDEWPSKYSKFFVELDDGLEF
SFTDKRRFARVRLFEDPEIVPPISELGSDALFEPMCVDTFADSLSGKKIGIKALLLDQSF
ISGIGNWIADEVLYQSRTHPLQIASSLSRESCEALHRSIQEVVKYAVEVDADCDRFPEEW
LFHHRWGKKPGKVNGKKIEFITAGGRTTAYVPQLQKLTGMQSASNKLVVSNPKQVAENDD
AKGIETDSEDADNTRKRVATSKAARGKQNSDAIGAGSRKRKNGGGKEKPSSDDGEDDTET
AELDIVSINSKGEIADPVTRRSSRNTSKPRQVFKSKGR
Download sequence
Identical sequences J3MG73
XP_015693859.1.55871 OB06G30170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]