SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB06G34290.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB06G34290.1
Domain Number 1 Region: 146-286
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-43
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 1037-1104
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000569
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB06G34290.1
Sequence length 1160
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:6:20703167:20711138:1 gene:OB06G34290 transcript:OB06G34290.1 description:"Uncharacterized protein "
Sequence
MMKQAQPQQQQPPVTASSTVTATAAAVTSAMAAAAAVGSGCEGEKKAPAINSELWHACAG
PLVSLPPAGSLVVYFPQGHSEQVAASMQKDVDAHVPSYPNLPSKLICLLHNVTLHADPET
DEVYAQMTLQPVTSYGKEALQLSELALKQARPQTEFFCKTLTASDTSTHGGFSVPRRAAE
KIFPPLDFSMQPPAQELQARDLHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDS
VIFVRDEKQQLLLGIRRANRQPTNISSSVLSSDSMHIGILAAAAHAAANNSPFTIFYNPR
ASPTEFVIPFAKYQKAVYGNQISLGMRFRMMFETEELGTRRYMGTITGISDLDPVRWKNS
QWRNLQVGWDESAAGERRNRVSIWEIEPVAAPFFICPPPFFGAKRPRQLDDESSEMENLL
KRAMPWLGEEICIKDPQTQNTIMPGLSLVQWMNMNMQQSSSFANTAMQSDYLRSLSNPNM
QNLGAADLSRQLCLQNQLLQQNNIQFNTPKLSQQMQPVNELSKATIPLNQLGVSTKPQEQ
IHDASNLARQQPSMNHILPLSQAQASFGQAQVLVQNQMQQQHASSTQGQQPTTSQPLLLP
QQQQQQQQQQKLLQQQQQQQQLLLQQQQLQQQQQLNKVPSQLPSLANQQLQLSDQQLQLQ
LLQKLQQQQQSLLSQPGVTLAQLPLIQEQQKLLLDMQQQLSNSQTLPQQQMMPQQSTRVP
SQNASLPPPVQQEPQQKLLQKQAMLADTSEAAVPLTTSANVISTMGSPLMTAGATHSVLT
EEIPSCSTSPSTANGGHLLQPILGRNKHCSMINTEKVPQPAAPMSVPSSLEAVTATPRMI
KESPKLNQNVKQTVVASKLANAGAGSQNYVNNPPPTDYLETASSATSVWLSQNDGLLHPN
FPMSNFSQPQMFKDAPPETEIHPPNTSNNALFGINSDGQLGFPMGTDDFLSNGIDAAKYE
NHISTEIDNGYRIPKDAQQEISSSMVSQSFGASDMAFNSIDSALNDGGFLNRSSWPPAPP
LKRMRTFTKVYKRGAVGRSIDISQFSGYDELKHALARMFSIEGQLEERQRIGWKLVYKDH
EDDILLLGDDPWEEFVGCVRCIRILSPQEVQQMSLEGCDLGNNSIPPNQACSSSDGGNAW
RARCDQNSGNPSNGSYEQFE
Download sequence
Identical sequences J3MHD5
XP_006656453.2.55871 OB06G34290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]