SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB08G18200.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB08G18200.1
Domain Number 1 Region: 291-339
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000314
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OB08G18200.1
Sequence length 627
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:8:6549969:6551852:1 gene:OB08G18200 transcript:OB08G18200.1 description:"Uncharacterized protein "
Sequence
MSSRSADTLGNDGGASSDHRNDAVVVVPSEEAAPTEGVTAGSSSDAPTGHAYVHGRDDVA
SPQVGQRGGGGAPAGSTDASVEPPLDPAATDQALRRCYIRLGKMTQHFTEASTALPAAAP
GPPAEKLMIDGIRAAATPRLPPRKNGDNACNDVPAAAPAALVTGVRFYSFSPELRRILEN
LDATEPEYVWQKVLAKSDVNLYHNRFLVSCKVNQLSNCPITHILTEEETHVVHSPTAPDD
IQAVENAAMAVVPVPVEEEVTVEDDIIKNEEEEEEEEEDKKKKKKKKEEEEKKKPGLTVM
MLDKSGNGYKTKCRYLESNGGYRFIEEWGKFLRTNGIGISEGQDWTRNVLVKLFAFRSQK
LPGAQQCGHPNGALGLVMEHHESESRDGGNIRKKKKPRMAMSSSSEIASTSSAARVSPEP
DVSVAAGGAAVAASSSASGMRPKRAAAVASSYSAEGMARKRAAAVAWSSSAAGMAPKRAA
VVASPSSAACMEPMRAAAVASTSSAVGMEFKTAVAAAAASYSAMDMAPTRAAAVASSSSA
AARMAHTRAAAAASSPSARSRMDHTRAAVASSSSAARMGMAPTRAAAVASSSSAGAAATA
PTWSTEEEKKRESEAVEGILKLRRLFS
Download sequence
Identical sequences J3MRU1
OB08G18200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]