SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB08G28560.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB08G28560.1
Domain Number 1 Region: 18-223
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.73e-67
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000339
Further Details:      
 
Domain Number 2 Region: 210-342
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.66e-42
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OB08G28560.1
Sequence length 353
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:8:16837375:16842442:1 gene:OB08G28560 transcript:OB08G28560.1 description:"Uncharacterized protein "
Sequence
MQALRPASSARAYSAAAKEMTVREALNSALDEEMSADPSVFLMGEEVGEYQGAYKISKGL
LDKYGPDRVLDTPITEAGFTGIGVGAAYQGLRPVVEFMTFNFSMQAIDHIINSAAKSNYM
SAGQISVPIVFRGPNGAAAGVGAQHSQCYAAWYAHVPGLKVLTPYSAEDARGLLKAAIRD
PDPVVFLENELLYGESFPVSAEALDSSFCLPIGKAKIEREGKDVTITAFSKMVGYALQAA
EILSKEGISAEVINLRSIRPLDRTAINASVRKTNRLVTVEEGFPQHGVGAEICMSVVEDS
FEYLDAPVERIAGADVPMPYAANLERMAVPQVEDIVRAAKRACYRAVPMAATA
Download sequence
Identical sequences J3MUS5
OB08G28560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]