SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB09G13070.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB09G13070.1
Domain Number 1 Region: 143-193
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000549
Family B3 DNA binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OB09G13070.1
Sequence length 360
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:9:4271353:4272461:1 gene:OB09G13070 transcript:OB09G13070.1 description:"Uncharacterized protein "
Sequence
MTTTTIGTRKRKFWAGLRNNGASTSSAGSGMVTSLDDIAVVHARLRDTLDDLGVSPERIF
GRRLTATDRDSVQSRLQMSCKSWHNNGASGEVFPFDQLLTLEEKLACNTSKPKTVAMSDE
QPKKKNNATKTKTKPIKGDDDNHVDNDGLLVQAYDRTGKPYVLRLKYIKKSDCYRLMYQW
TDFLKNHNLVVKDDTKKTKKNKAKKKRKKKVIRKVAMADEAMIDLWVFRSWKLKYGRDDH
EDGRLGLVMVHYFKGDAPYADAALEANDEELVQARPRKKKSRRKDRKGAMSSSSSQCRTR
KTKQPWRLPSAMAGEDEGGAVRQLAEIAGEGAGVPHLPTYDPEMEWAAGVLLHMRNFGRW
Download sequence
Identical sequences J3MWC8
OB09G13070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]