SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB09G22540.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB09G22540.1
Domain Number 1 Region: 41-246
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.44e-68
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000339
Further Details:      
 
Domain Number 2 Region: 231-365
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.66e-42
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB09G22540.1
Sequence length 376
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:9:11468867:11475011:1 gene:OB09G22540 transcript:OB09G22540.1 description:"Uncharacterized protein "
Sequence
MLGAVRRQLGSGPMLGQVLRRLRPATAAAAGGARGCSASAKEMTVREALNSALDEEMSAD
PSVFLMGEEVGEYQGAYKISKGLLDKYGPDRVLDTPITEAGFTGIAVGAAYQGLRPVVEF
MTFNFSMQAIDHIINSAAKSNYMSAGQISVPIVFRGPNGAAAGVGAQHSQCYAAWYAHVP
GLKVLAPYSAEDARGLLKAAIRDPDPVVFLENELLYGESFPISAEVLDSSFSLPIGKAKV
EREGKDVTITAYSKMVGYALKAAEILSKEGISAEVINLRSIRPLDRAAINASVRKTNRLV
TVEESFPQHGIGAEICMSVVEESFEYLDAPVERIAGADVPMPYAANLERKAVPQIDDIVR
AAKRACYRAVPMAATA
Download sequence
Identical sequences J3MZ25
XP_015696781.1.55871 OB09G22540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]