SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB10G15410.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB10G15410.1
Domain Number 1 Region: 95-148
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000762
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OB10G15410.1
Sequence length 191
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:10:6182054:6183893:-1 gene:OB10G15410 transcript:OB10G15410.1 description:""
Sequence
MPDIMAASRAQGLRVRLTTLGPFFRVTAARRCGXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPWPGGSVLHLDSMRMSRATLRVPDRPIFGLGLFLGAVAVRHGFDAGCKRAELLA
INDTPTYHSKLVRFYTRMGFKTVHEVDGSSVTDLAHMLVWGGRGTRMDADIEQLLIKWSK
RFTSQESRLER
Download sequence
Identical sequences J3N1Z3
OB10G15410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]